Overview

  • Product name
    Anti-p95 NBS1 antibody [7E4A2]
    See all p95 NBS1 primary antibodies
  • Description
    Mouse monoclonal [7E4A2] to p95 NBS1
  • Host species
    Mouse
  • Tested applications
    Suitable for: Flow Cyt, IHC-P, WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Rat, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human p95 NBS1 aa 467-615. Expressed in E. Coli.
    Sequence:

    ERDEENQEMSSCKSARIETSCSLLEQTQPATPSLWKNKEQHLSENEPVDT NSDNNLFTDTDLKSIVKNSASKSHAAEKLRSNKKREMDDVAIEDEVLEQL FKDTKPELEIDVKVQKQEEDVNVRKRPRMDIETNDTFSDEAVPESSKIS


    Database link: O60934

  • Positive control
    • A549, Jurkat and PC-12 cell lysates; p95 NBS1 (aa 467-615) recombinant protein; p95 NBS1 (aa 467-615)-hIgGFc transfected HEK293 cell lysate; Hela cells; Human cervical cancer and Human rectum cancer tissues.
  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR150721-8 are from Tissue Culture Supernatant

Properties

Applications

Our Abpromise guarantee covers the use of ab181729 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/200 - 1/400.

ab170191 - Mouse monoclonal IgG2a, is suitable for use as an isotype control with this antibody.

 

IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 84 kDa.
ICC/IF 1/200 - 1/1000.

Target

  • Function
    Component of the MRE11-RAD50-NBN (MRN complex) which plays a critical role in the cellular response to DNA damage and the maintenance of chromosome integrity. The complex is involved in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity, cell cycle checkpoint control and meiosis. The complex possesses single-strand endonuclease activity and double-strand-specific 3'-5' exonuclease activity, which are provided by MRE11A. RAD50 may be required to bind DNA ends and hold them in close proximity. NBN modulate the DNA damage signal sensing by recruiting PI3/PI4-kinase family members ATM, ATR, and probably DNA-PKcs to the DNA damage sites and activating their functions. It can also recruit MRE11 and RAD50 to the proximity of DSBs by an interaction with the histone H2AX. NBN also functions in telomere length maintenance by generating the 3' overhang which serves as a primer for telomerase dependent telomere elongation. NBN is a major player in the control of intra-S-phase checkpoint and there is some evidence that NBN is involved in G1 and G2 checkpoints. The roles of NBS1/MRN encompass DNA damage sensor, signal transducer, and effector, which enable cells to maintain DNA integrity and genomic stability. Forms a complex with RBBP8 to link DNA double-strand break sensing to resection. Enhances AKT1 phosphorylation possibly by association with the mTORC2 complex.
  • Tissue specificity
    Ubiquitous. Expressed at high levels in testis.
  • Involvement in disease
    Nijmegen breakage syndrome
    Breast cancer
    Aplastic anemia
    Defects in NBN might play a role in the pathogenesis of childhood acute lymphoblastic leukemia (ALL).
  • Sequence similarities
    Contains 1 BRCT domain.
    Contains 1 FHA domain.
  • Domain
    The FHA and BRCT domains are likely to have a crucial role for both binding to histone H2AFX and for relocalization of MRE11/RAD50 complex to the vicinity of DNA damage.
    The C-terminal domain contains a MRE11-binding site, and this interaction is required for the nuclear localization of the MRN complex.
    The EEXXXDDL motif at the C-terminus is required for the interaction with ATM and its recruitment to sites of DNA damage and promote the phosphorylation of ATM substrates, leading to the events of DNA damage response.
  • Post-translational
    modifications
    Phosphorylated by ATM in response of ionizing radiation, and such phosphorylation is responsible intra-S phase checkpoint control and telomere maintenance.
  • Cellular localization
    Nucleus. Nucleus, PML body. Chromosome, telomere. Localizes to discrete nuclear foci after treatment with genotoxic agents.
  • Information by UniProt
  • Database links
  • Alternative names
    • AT V1 antibody
    • AT V2 antibody
    • ATV antibody
    • Cell cycle regulatory protein p95 antibody
    • FLJ10155 antibody
    • MGC87362 antibody
    • Nbn antibody
    • NBN_HUMAN antibody
    • NBS 1 antibody
    • NBS antibody
    • NBS1 antibody
    • Nibrin antibody
    • Nijmegen breakage syndrome 1 (nibrin) antibody
    • Nijmegen breakage syndrome antibody
    • Nijmegen breakage syndrome protein 1 antibody
    • p95 antibody
    • p95 protein of the MRE11/RAD50 complex antibody
    see all

Images

  • Immunofluorescent analysis of HeLa cells labeling p95 NBS1 with ab181729 at 1/200 (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.

  • All lanes : Anti-p95 NBS1 antibody [7E4A2] (ab181729) at 1/500 dilution

    Lane 1 : A549 cell lysate
    Lane 2 : Jurkat cell lysate
    Lane 3 : PC-12 cell lysate

    Predicted band size: 84 kDa

  • All lanes : Anti-p95 NBS1 antibody [7E4A2] (ab181729) at 1/500 dilution

    Lane 1 : non-transfected HEK293 cell lysate
    Lane 2 : p95 NBS1 (aa 467-615)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 84 kDa

  • Anti-p95 NBS1 antibody [7E4A2] (ab181729) at 1/500 dilution + p95 NBS1 (aa 467-615) recombinant protein

    Predicted band size: 84 kDa

  • Immunohistochemical analysis of paraffin embedded Human rectum cancer tissue labeling p95 NBS1 with ab181729 at 1/200 with DAB staining.

  • Immunohistochemical analysis of paraffin embedded Human cervical cancer tissue labeling p95 NBS1 with ab181729 at 1/200 with DAB staining.

  • Flow Cytometrical analysis of HeLa cells labeling p95 NBS1 with ab181729 at 1/200 (green) compared to a negative control antibody (red).

References

ab181729 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181729.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up