Overview

  • Product name
  • Description
    Rabbit polyclonal to PAIP1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human PAIP1 aa 379-459.
    Sequence:

    RVHATSTYREATPENDPNYFMNEPTFYTSDGVPFTAADPDYQEKYQELLE REDFFPDYEENGTDLSGAGDPYLDDIDDEMD


    Database link: Q9H074

  • Positive control
    • ICC/IF: U-2 OS cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221888 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function
    Acts as a coactivator in the regulation of translation initiation of poly(A)-containing mRNAs. Its stimulatory activity on translation is mediated via its action on PABPC1. Competes with PAIP2 for binding to PABPC1. Its association with EIF4A and PABPC1 may potentiate contacts between mRNA termini. May also be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain.
  • Sequence similarities
    Contains 1 MIF4G domain.
  • Domain
    Only the PABPC1-interacting motif-1 (PAM1) stimulates translation initiation.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • MGC12360 antibody
    • OTTHUMP00000221601 antibody
    • OTTMUSP00000026880 antibody
    • PABC1 interacting protein 1 antibody
    • PABP interacting protein 1 antibody
    • PABP-interacting protein 1 antibody
    • PAIP 1 antibody
    • PAIP-1 antibody
    • Paip1 antibody
    • PAIP1_HUMAN antibody
    • Poly(A) binding protein interacting protein 1 antibody
    • Poly(A)-binding protein-interacting protein 1 antibody
    • Polyadenylate binding protein interacting protein 1 antibody
    • Polyadenylate-binding protein-interacting protein 1 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for PAIP1 (green) using ab221888 at 4 µg/ml in ICC/IF.

References

ab221888 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221888.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up