Anti-Pancreatic alpha amylase antibody (ab189341)

Overview

  • Product name
    Anti-Pancreatic alpha amylase antibody
    See all Pancreatic alpha amylase primary antibodies
  • Description
    Sheep polyclonal to Pancreatic alpha amylase
  • Host species
    Sheep
  • Specificity
    This antibody recongizes native AMY2A
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human, Pig
  • Immunogen

    Full length native protein (purified) corresponding to Human Pancreatic alpha amylase aa 16-511.
    Sequence:

    QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVA IYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVIN HMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIEN YNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASK HMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGN GRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHD NQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQN GNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNV VDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYC DVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL


    Database link: P04746

  • Positive control
    • Human pancreas tissue.

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab189341 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 2.5 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
WB Use at an assay dependent concentration. Predicted molecular weight: 58 kDa.

Target

  • Relevance
    Pancreatic amylase is a digestive enzyme secreted by the pancreas. It consists of a single polypeptide chain with a molecular weight of 54 kDa. Pancreatic amylase occurs in serum at a concentration of about 60µg/L, from a total amylase concentration in serum of about 120µg/L. Pancreatic amylase and salivary amylase are the products of separate genes and, although they share 98% amino acid sequence homology, they differ in molecular size, isoelectric point and antigenic properties. Measurement of amylase concentrations in serum is a diagnostic test for various pancreatic disorders (especially acute and relapsing pancreatitis).
  • Cellular localization
    Secreted protein; extracellular space.
  • Database links
  • Alternative names
    • 1 4 alpha D glucan glucanohydrolase antibody
    • 1,4 alpha D glucan glucanohydrolase 2B antibody
    • Alpha amylase 2B antibody
    • Alpha amylase antibody
    • AMY2 antibody
    • AMY2A antibody
    • AMY2B antibody
    • AMY3 antibody
    • Amylase alpha 2A antibody
    • Amylase alpha 2A pancreatic antibody
    • Amylase alpha 2B antibody
    • Amylase alpha 2B pancreatic antibody
    • Amylase pancreatic alpha 2A antibody
    • Amylase pancreatic alpha 2B antibody
    • Amylase, alpha 2A (pancreatic) antibody
    • Amylase, alpha 2B (pancreatic) antibody
    • Carcinoid alpha amylase antibody
    • Found in the pancreas antibody
    • Glycogenase antibody
    • HXA antibody
    • PA antibody
    • Pancreatic alpha amylase antibody
    • Pancreatic amylase 2A antibody
    • Pancreatic amylase alpha 2A antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human pancreas tissue, labeling AMY2A using ab189341 at 2.5 µg/ml.

References

ab189341 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189341.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up