Overview

  • Product nameAnti-PAP2D antibody
    See all PAP2D primary antibodies
  • Description
    Rabbit polyclonal to PAP2D
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 36-85 (

    FTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGET

    ) of human PAP2D (NP_001010861).

  • Positive control
    • Jurkat cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab84659 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-PAP2D antibody images

  • Anti-PAP2D antibody (ab84659) at 1 µg/ml (in 5% skim milk / PBS buffer) + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 35 kDa
    Observed band size : 40 kDa (why is the actual band size different from the predicted?)

References for Anti-PAP2D antibody (ab84659)

This product has been referenced in:
  • Coiro P  et al. Plasticity-related gene 5 promotes spine formation in murine hippocampal neurons. J Biol Chem 289:24956-70 (2014). WB ; Mouse . Read more (PubMed: 25074937) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab84659.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"