Overview

  • Product name
  • Description
    Rabbit polyclonal to PAPLN
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide corresponding to Human PAPLN aa 1186-1271.
    Sequence:

    TLLIYNLRARDEGSYTCSAYQGSQAVSRSTEVKVVSPAPTAQPRDPGRDC VDQPELANCDLILQAQLCGNEYYSSFCCASCSRFQP


    Database link: O95428

  • Positive control
    • Human colon tissue

Properties

Applications

Our Abpromise guarantee covers the use of ab185091 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol

Target

Images

  • Immunohistochemical analysis of paraffin-embedded Human colon tissue labeling PAPLN with ab185091 at 1/50 dilution.

References

ab185091 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185091.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up