Overview

  • Product nameAnti-Paralemmin antibody
    See all Paralemmin primary antibodies
  • Description
    Rabbit polyclonal to Paralemmin
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Cat, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 35-84 (

    LEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDLRRQMQDDEQKTRLL

    ) of Human Paralemmin (NP_001035224).

  • Positive control
    • MCF7 Cell Lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab108239 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 42 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-Paralemmin antibody images

  • Anti-Paralemmin antibody (ab108239) at 1 µg/ml + MCF7 Cell Lysate at 10 µg

    Predicted band size : 42 kDa

References for Anti-Paralemmin antibody (ab108239)

This product has been referenced in:
  • Konzer A  et al. Stable isotope labeling in zebrafish allows in vivo monitoring of cardiac morphogenesis. Mol Cell Proteomics 12:1502-12 (2013). Read more (PubMed: 23412571) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab108239.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"