Anti-Parathyroid Hormone antibody [A1/70] (ab14493)

Overview

  • Product nameAnti-Parathyroid Hormone antibody [A1/70]
    See all Parathyroid Hormone primary antibodies
  • Description
    Mouse monoclonal [A1/70] to Parathyroid Hormone
  • Specificityab14493 recognises parathyroid hormone peptides (aa 15-25; 1-34; 1-38; 1-84; 7-84). There are no cross reactivities obtained with synthetic parathyroid hormone peptides (aa 1-3; 1-10; 4-16; 28-48; 39-84; 44-68; 53-84) and PTHrP (aa 1-86).
  • Tested applicationsSuitable for: ELISA, RIA, IHC-Fr, IHC-P, Sandwich ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Cow, Cat, Dog, Pig, Cynomolgus Monkey
  • Immunogen

    Poly lysin conjugated synthetic peptide:

    SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG

    , corresponding to amino acids 1-38 of Human Parathyroid Hormone.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.15M Sodium Chloride, 0.01M Sodium Phosphate. pH 7.2
  • Concentration information loading...
  • PurityProtein A purified
  • Purification notesCell supernatant, Prot. A purified.
  • ClonalityMonoclonal
  • Clone numberA1/70
  • IsotypeIgA
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab14493 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use a concentration of 1 µg/ml.
RIA Use at an assay dependent concentration. Use at a concentration of 2 ng/ml
IHC-Fr Use a concentration of 2 µg/ml.
IHC-P Use a concentration of 2 µg/ml.
Sandwich ELISA Use a concentration of 0.2 µg/ml. Can be paired for Sandwich ELISA with Rabbit polyclonal to Parathyroid Hormone (ab53040). For sandwich ELISA, use this antibody as Capture at 0.2µg/ml with ab53040 as Detection.

Target

  • FunctionPTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
  • Involvement in diseaseDefects in PTH are a cause of familial isolated hypoparathyroidism (FIH) [MIM:146200]; also called autosomal dominant hypoparathyroidism or autosomal dominant hypocalcemia. FIH is characterized by hypocalcemia and hyperphosphatemia due to inadequate secretion of parathyroid hormone. Symptoms are seizures, tetany and cramps. FIH exist both as autosomal dominant and recessive forms of hypoparathyroidism.
  • Sequence similaritiesBelongs to the parathyroid hormone family.
  • Cellular localizationSecreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • hPTH antibody
    • Parathormone antibody
    • Parathyrin antibody
    • Parathyroid hormone 1 antibody
    • Parathyroid hormone antibody
    • PTH antibody
    • PTH1 antibody
    • PTH1 receptor antibody
    • PTH1R antibody
    • PTHR antibody
    • PTHR1 antibody
    • PTHY_HUMAN antibody
    see all

Anti-Parathyroid Hormone antibody [A1/70] images

Protocols

References for Anti-Parathyroid Hormone antibody [A1/70] (ab14493)

ab14493 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab14493.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"