Anti-Parathyroid Hormone antibody [A1/70] (ab14493)

Overview

  • Product name
    Anti-Parathyroid Hormone antibody [A1/70]
    See all Parathyroid Hormone primary antibodies
  • Description
    Mouse monoclonal [A1/70] to Parathyroid Hormone
  • Specificity
    ab14493 recognises parathyroid hormone peptides (aa 15-25; 1-34; 1-38; 1-84; 7-84). There are no cross reactivities obtained with synthetic parathyroid hormone peptides (aa 1-3; 1-10; 4-16; 28-48; 39-84; 44-68; 53-84) and PTHrP (aa 1-86).
  • Tested applications
    Suitable for: ELISA, RIA, IHC-Fr, IHC-P, Sandwich ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Cow, Cat, Dog, Pig, Cynomolgus monkey
  • Immunogen

    Poly lysin conjugated synthetic peptide:

    SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG

    , corresponding to amino acids 1-38 of Human Parathyroid Hormone.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 0.15M Sodium Chloride, 0.01M Sodium Phosphate. pH 7.2
  • Concentration information loading...
  • Purity
    Protein A purified
  • Purification notes
    Cell supernatant, Prot. A purified.
  • Clonality
    Monoclonal
  • Clone number
    A1/70
  • Isotype
    IgA
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab14493 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use a concentration of 1 µg/ml.
RIA Use at an assay dependent concentration. Use at a concentration of 2 ng/ml
IHC-Fr Use a concentration of 2 µg/ml.
IHC-P Use a concentration of 2 µg/ml.
Sandwich ELISA Use a concentration of 0.2 µg/ml. Can be paired for Sandwich ELISA with Rabbit polyclonal to Parathyroid Hormone (ab53040). For sandwich ELISA, use this antibody as Capture at 0.2µg/ml with ab53040 as Detection.

Target

  • Function
    PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
  • Involvement in disease
    Defects in PTH are a cause of familial isolated hypoparathyroidism (FIH) [MIM:146200]; also called autosomal dominant hypoparathyroidism or autosomal dominant hypocalcemia. FIH is characterized by hypocalcemia and hyperphosphatemia due to inadequate secretion of parathyroid hormone. Symptoms are seizures, tetany and cramps. FIH exist both as autosomal dominant and recessive forms of hypoparathyroidism.
  • Sequence similarities
    Belongs to the parathyroid hormone family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • hPTH antibody
    • Parathormone antibody
    • Parathyrin antibody
    • Parathyroid hormone 1 antibody
    • Parathyroid hormone antibody
    • Prepro PTH antibody
    • Preproparathyroid hormone antibody
    • PTH antibody
    • PTH1 antibody
    • PTH1 receptor antibody
    • PTH1R antibody
    • PTHR antibody
    • PTHR1 antibody
    • PTHY_HUMAN antibody
    see all

Images

References

ab14493 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab14493.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up