Anti-Parathyroid Hormone antibody [B1/70] (ab14496)

Overview

  • Product name
    Anti-Parathyroid Hormone antibody [B1/70]
    See all Parathyroid Hormone primary antibodies
  • Description
    Mouse monoclonal [B1/70] to Parathyroid Hormone
  • Specificity
    Ab14496 reacts with parathyroid hormone peptides:aa 15-25; 1-34; 1-38; 1-84; 7-84. There are no cross reactivities with parathyroid hormone peptides: aa 1-3; 1-10; 4-16; 28-48; 39-84; 44-68; 53-84; PTHrP aa 1- 86.
  • Tested applications
    Suitable for: ELISA, IHC-P, IHC-Fr, RIAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Horse, Cow, Cat, Dog, Pig, Macaque monkey
  • Immunogen

    Poly Lysin conjugated synthetic peptide:

    SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG

    , corresponding to amino acids 1-38 of Human Parathyroid Hormone.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: 0.05% Sodium Azide
    Constituents: 50mM Tris. pH 7.4
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Monoclonal
  • Clone number
    B1/70
  • Isotype
    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab14496 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA
IHC-P
IHC-Fr
RIA
  • Application notes
    ELISA: Use at a concentration of 1 µg/ml.
    IHC-P: Use at a concentration of 2 µg/ml.
    IHC-Fr: Use at a concentration of 2 µg/ml.
    RIA: Use at a concentration of 25 ng/ml.

    Not tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Target

    • Function
      PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
    • Involvement in disease
      Defects in PTH are a cause of familial isolated hypoparathyroidism (FIH) [MIM:146200]; also called autosomal dominant hypoparathyroidism or autosomal dominant hypocalcemia. FIH is characterized by hypocalcemia and hyperphosphatemia due to inadequate secretion of parathyroid hormone. Symptoms are seizures, tetany and cramps. FIH exist both as autosomal dominant and recessive forms of hypoparathyroidism.
    • Sequence similarities
      Belongs to the parathyroid hormone family.
    • Cellular localization
      Secreted.
    • Information by UniProt
    • Database links
    • Alternative names
      • hPTH antibody
      • Parathormone antibody
      • Parathyrin antibody
      • Parathyroid hormone 1 antibody
      • Parathyroid hormone antibody
      • Prepro PTH antibody
      • Preproparathyroid hormone antibody
      • PTH antibody
      • PTH1 antibody
      • PTH1 receptor antibody
      • PTH1R antibody
      • PTHR antibody
      • PTHR1 antibody
      • PTHY_HUMAN antibody
      see all

    References for Anti-Parathyroid Hormone antibody [B1/70] (ab14496)

    ab14496 has not yet been referenced specifically in any publications.

    Product Wall

    There are currently no Abreviews or Questions for ab14496.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up