Anti-Parathyroid Hormone antibody [B1/70] (ab14496)

Overview

  • Product nameAnti-Parathyroid Hormone antibody [B1/70]
    See all Parathyroid Hormone primary antibodies
  • Description
    Mouse monoclonal [B1/70] to Parathyroid Hormone
  • SpecificityAb14496 reacts with parathyroid hormone peptides:aa 15-25; 1-34; 1-38; 1-84; 7-84. There are no cross reactivities with parathyroid hormone peptides: aa 1-3; 1-10; 4-16; 28-48; 39-84; 44-68; 53-84; PTHrP aa 1- 86.
  • Tested applicationsSuitable for: ELISA, IHC-P, IHC-Fr, RIAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Horse, Cow, Cat, Dog, Pig, Macaque Monkey
  • Immunogen

    Poly Lysin conjugated synthetic peptide:

    SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG

    , corresponding to amino acids 1-38 of Human Parathyroid Hormone.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: 0.05% Sodium Azide
    Constituents: 50mM Tris. pH 7.4
  • Concentration information loading...
  • PurityProtein A purified
  • ClonalityMonoclonal
  • Clone numberB1/70
  • IsotypeIgG1
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab14496 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA
IHC-P
IHC-Fr
RIA
  • Application notesELISA: Use at a concentration of 1 µg/ml.
    IHC-P: Use at a concentration of 2 µg/ml.
    IHC-Fr: Use at a concentration of 2 µg/ml.
    RIA: Use at a concentration of 25 ng/ml.

    Not tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Target

    • FunctionPTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
    • Involvement in diseaseDefects in PTH are a cause of familial isolated hypoparathyroidism (FIH) [MIM:146200]; also called autosomal dominant hypoparathyroidism or autosomal dominant hypocalcemia. FIH is characterized by hypocalcemia and hyperphosphatemia due to inadequate secretion of parathyroid hormone. Symptoms are seizures, tetany and cramps. FIH exist both as autosomal dominant and recessive forms of hypoparathyroidism.
    • Sequence similaritiesBelongs to the parathyroid hormone family.
    • Cellular localizationSecreted.
    • Information by UniProt
    • Database links
    • Alternative names
      • hPTH antibody
      • Parathormone antibody
      • Parathyrin antibody
      • Parathyroid hormone 1 antibody
      • Parathyroid hormone antibody
      • PTH antibody
      • PTH1 antibody
      • PTH1 receptor antibody
      • PTH1R antibody
      • PTHR antibody
      • PTHR1 antibody
      • PTHY_HUMAN antibody
      see all

    References for Anti-Parathyroid Hormone antibody [B1/70] (ab14496)

    ab14496 has not yet been referenced specifically in any publications.

    Product Wall

    There are currently no Abreviews or Questions for ab14496.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"