Anti-PARP2 antibody [AT29G4] (ab177529)

Overview

  • Product name
    Anti-PARP2 antibody [AT29G4]
    See all PARP2 primary antibodies
  • Description
    Mouse monoclonal [AT29G4] to PARP2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human PARP2 aa 233-583. purified from E.coli
    Sequence:

    QLDLRVQELIKLICNVQAMEEMMMEMKYNTKKAPLGKLTVAQIKAGYQSL KKIEDCIRAG QHGRALMEACNEFYTRIPHDFGLRTPPLIRTQKELSEKIQLLEALGDIEI AIKLVKTELQ SPEHPLDQHYRNLHCALRPLDHESYEFKVISQYLQSTHAPTHSDYTMTLL DLFEVEKDGE KEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAPPEAPITGYMFGKGIY FADMSSKSAN YCFASRLKNTGLLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMA PSSAHFVTLN GSTVPLGPASDTGILNPDGYTLNYNEYIVYNPNQVRMRYLLKVQFNFLQL W


    Database link: Q9UGN5

  • Positive control
    • HeLa cell lysate
  • General notes

    ab177529 is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with a recombinant Human PARP2 fragment protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab177529 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 66 kDa.

Target

  • Function
    Involved in the base excision repair (BER) pathway, by catalyzing the poly(ADP-ribosyl)ation of a limited number of acceptor proteins involved in chromatin architecture and in DNA metabolism. This modification follows DNA damages and appears as an obligatory step in a detection/signaling pathway leading to the reparation of DNA strand breaks.
  • Tissue specificity
    Widely expressed, mainly in actively dividing tissues. The highest levels are in the brain, heart, pancreas, skeletal muscle and testis; also detected in kidney, liver, lung, placenta, ovary and spleen; levels are low in leukocytes, colon, small intestine, prostate and thymus.
  • Sequence similarities
    Contains 1 PARP alpha-helical domain.
    Contains 1 PARP catalytic domain.
  • Post-translational
    modifications
    Poly-ADP-ribosylated by PARP1.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • ADP ribosyltransferase like 2 antibody
    • ADP-ribosyltransferase diphtheria toxin-like 2 antibody
    • ADPRT 2 antibody
    • ADPRT-2 antibody
    • ADPRT2 antibody
    • ADPRTL 2 antibody
    • ADPRTL 3 antibody
    • ADPRTL2 antibody
    • ADPRTL3 antibody
    • ARTD2 antibody
    • hPARP 2 antibody
    • hPARP-2 antibody
    • hPARP2 antibody
    • NAD(+) ADP ribosyltransferase 2 antibody
    • NAD(+) ADP-ribosyltransferase 2 antibody
    • pADPRT 2 antibody
    • pADPRT-2 antibody
    • pADPRT2 antibody
    • PARP 2 antibody
    • PARP-2 antibody
    • PARP2 antibody
    • PARP2_HUMAN antibody
    • Poly (ADP ribose) polymerase family member 2 antibody
    • Poly (ADP ribosyl) transferase like 2 antibody
    • poly (ADP-ribose) polymerase 2 antibody
    • Poly [ADP ribose] synthetase 2 antibody
    • Poly [ADP-ribose] polymerase 2 antibody
    • Poly(ADP ribose) synthetase antibody
    • Poly[ADP-ribose] synthase 2 antibody
    see all

Images

  • Lane 1 : Anti-PARP2 antibody [AT29G4] (ab177529) at 1/500 dilution
    Lane 2 : Anti-PARP2 antibody [AT29G4] (ab177529) at 1/1000 dilution
    Lane 3 : Anti-PARP2 antibody [AT29G4] (ab177529) at 1/5000 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : HeLa cell lysate
    Lane 3 : HeLa cell lysate

    Lysates/proteins at 40 µg per lane.

    Secondary
    goat anti-mouse secondary antibody conjugated to HRP
    Developed using the ECL technique

    Predicted band size : 66 kDa

    PVDF membrane

References

ab177529 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (HeLa)
Permeabilization
Yes - 0.5% TritonX100 in PBS
Specification
HeLa
Fixative
Paraformaldehyde
Username

Dr. Kirk Mcmanus

Verified customer

Submitted Jul 20 2015

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up