Overview

  • Product nameAnti-PAS1C1 antibody
    See all PAS1C1 primary antibodies
  • Description
    Rabbit polyclonal to PAS1C1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 324-373 (

    PTVFPNRSPWCQNPYVSAHPYCPLIEPHNTSTAGGRLDRQPRSRSTRPNR

    ) of Human PAS1C1 (NP_689803).

  • Positive control
    • Fetal intestine lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab90129 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Sequence similaritiesBelongs to the intermediate filament family.
  • Information by UniProt
  • Database links
  • Alternative names
    • IFLTD1 antibody
    • ILFT1_HUMAN antibody
    • Intermediate filament tail domain containing 1 antibody
    • Intermediate filament tail domain containing protein 1 antibody
    • Intermediate filament tail domain-containing protein 1 antibody
    • Lamin A related sequence 1 protein antibody
    • Lmna rs1 antibody
    • Lmna1 antibody
    see all

Anti-PAS1C1 antibody images

  • Anti-PAS1C1 antibody (ab90129) at 1 µg/ml (5% skim milk / PBS buffer) + Human fetal intestine lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 43 kDa

References for Anti-PAS1C1 antibody (ab90129)

ab90129 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90129.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"