Overview

  • Product name
  • Description
    Rabbit polyclonal to PBK
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (proprietary-tag) corresponding to Human PBK aa 4-136.
    Sequence:

    ISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSP RGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAF TEANDGSLCLAMEYGGEKSLNDLIEERYKASQD


    Database link: Q96KB5

  • Positive control
    • Human testis tissue; RT-4 and U-251 MG cell line lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab220106 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 36 kDa.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Phosphorylates MAP kinase p38. Seems to be active only in mitosis. May also play a role in the activation of lymphoid cells. When phosphorylated, forms a complex with TP53, leading to TP53 destabilization and attenuation of G2/M checkpoint during doxorubicin-induced DNA damage.
  • Tissue specificity
    Expressed in the testis and placenta. In the testis, restrictedly expressed in outer cell layer of seminiferous tubules.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase kinase subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylated; in a cell-cycle dependent manner at mitosis.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cancer/testis antigen 84 antibody
    • CT84 antibody
    • Epididymis luminal protein 164 antibody
    • FLJ14385 antibody
    • HEL164 antibody
    • Lymphokine activated killer T cell originated protein kinase antibody
    • Lymphokine-activated killer T-cell-originated protein kinase antibody
    • MAPKK like protein kinase antibody
    • MAPKK-like protein kinase antibody
    • Nori 3 antibody
    • Nori-3 antibody
    • Nori3 antibody
    • PBK antibody
    • PDZ binding kinase antibody
    • PDZ-binding kinase antibody
    • Serine/threonine protein kinase antibody
    • Spermatogenesis related protein kinase antibody
    • Spermatogenesis-related protein kinase antibody
    • SPK antibody
    • T LAK cell originated protein kinase antibody
    • T-LAK cell-originated protein kinase antibody
    • TOPK antibody
    • TOPK_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed and paraffin-embedded Human testis tissue labeling PBK with ab220106 at 1/1000 dilution.

  • All lanes : Anti-PBK antibody (ab220106) at 1/250 dilution

    Lane 1 : RT-4 cell line lysate
    Lane 2 : U-251 MG cell line lysate

    Predicted band size: 36 kDa

References

ab220106 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220106.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up