
  • Product nameAnti-PBLD antibody
    See all PBLD primary antibodies
  • Description
    Rabbit polyclonal to PBLD
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide, corresponding to N a region within terminal amino acids 1-50 (KLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFI R) of Human PBLD (NP_001028255).

  • Positive control
    • Human Fetal Liver Lysate


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • Purification notesPurified by peptide affinity chromatography method.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas


Our Abpromise guarantee covers the use of ab84339 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 32 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-PBLD antibody images

  • Anti-PBLD antibody (ab84339) at 1 µg/ml + Human Fetal Liver Lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1: 50,000

    Predicted band size : 32 kDa
    Observed band size : 32 kDa

References for Anti-PBLD antibody (ab84339)

ab84339 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84339.
Please use the links above to contact us or submit feedback about this product.