Overview

  • Product name
  • Description
    Mouse polyclonal to PBR
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human PBR aa 1-169.
    Sequence:

    MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLG PVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFF GARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTL NYCVWRDNHGWHGGRRLPE


    Database link: AAH01110.1

  • Positive control
    • PBR-transfected 293T cell lysate.

Applications

Our Abpromise guarantee covers the use of ab171776 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 19 kDa.

Target

  • Function
    Responsible for the manifestation of peripheral-type benzodiazepine recognition sites and is most likely to comprise binding domains for benzodiazepines and isoquinoline carboxamides. May play a role in the transport of porphyrins and heme. Plays a role in the transport of cholesterol across mitochondrial membranes in steroidogenic cells.
  • Tissue specificity
    Found in many tissue types. Expressed at the highest levels under normal conditions in tissues that synthesize steroids.
  • Sequence similarities
    Belongs to the TspO/BZRP family.
  • Cellular localization
    Mitochondrion membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Benzodiazapine receptor (peripheral) antibody
    • Benzodiazepine peripheral binding site antibody
    • BPBS antibody
    • BZRP antibody
    • DBI antibody
    • IBP antibody
    • Isoquinoline carboxamide-binding protein antibody
    • MBR antibody
    • mDRC antibody
    • Mitochondrial benzodiazepine receptor antibody
    • PBR antibody
    • PBS antibody
    • Peripheral benzodiazepine receptor antibody
    • Peripheral benzodiazepine receptor-related protein antibody
    • Peripheral type benzodiazepine receptor antibody
    • Peripheral-type benzodiazepine receptor antibody
    • pk18 antibody
    • PKBS antibody
    • PTBR antibody
    • Ptbzr antibody
    • PTBZR02 antibody
    • RATPTBZR02 antibody
    • translocator protein (18kDa) antibody
    • Translocator protein antibody
    • Tspo antibody
    • Tspo1 antibody
    • TSPOA_HUMAN antibody
    see all

Images

  • All lanes : Anti-PBR antibody (ab171776) at 1 µg/ml

    Lane 1 : PBR-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate secondary antibody at 1/2500 dilution

    Predicted band size: 19 kDa

References

ab171776 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171776.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up