Overview

  • Product name
    Anti-PCBP1 antibody [AT2A10]
    See all PCBP1 primary antibodies
  • Description
    Mouse monoclonal [AT2A10] to PCBP1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rabbit, Cow
  • Immunogen

    Recombinant fragment corresponding to Human PCBP1 aa 1-163. Purified from E. coli.
    Sequence:

    MDAGVTESGLNVTLTIRLLMHGKEVGSIIGKKGESVKRIREESGARINIS EGNCPERIITLTGPTNAIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTL RLVVPATQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAG VPQSVTECVKQIC


    Database link: Q15365

  • Positive control
    • HeLa and HepG2 lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab180256 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500. Predicted molecular weight: 37 kDa.

Target

  • Function
    Single-stranded nucleic acid binding protein that binds preferentially to oligo dC.
  • Tissue specificity
    Abundantly expressed in skeletal muscle, thymus and peripheral blood leukocytes while a lower expression is observed in prostate, spleen, testis, ovary, small intestine, heart, liver, adrenal and thyroid glands.
  • Sequence similarities
    Contains 3 KH domains.
  • Post-translational
    modifications
    Phosphorylated; lowers poly(rC)-binding activity.
  • Cellular localization
    Nucleus. Cytoplasm. Loosely bound in the nucleus. May shuttle between the nucleus and the cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • Alpha-CP1 antibody
    • Heterogeneous nuclear ribonucleoprotein E1 antibody
    • heterogenous nuclear ribonucleoprotein E1 antibody
    • heterogenous nuclear ribonucleoprotein X antibody
    • hnRNP E1 antibody
    • hnRNP-E1 antibody
    • hnRNP-X antibody
    • HNRPE1 antibody
    • HNRPX antibody
    • nucleic acid binding protein sub 2.3 antibody
    • Nucleic acid- binding protein SUB2.3 antibody
    • Nucleic acid-binding protein SUB2.3 antibody
    • PCBP1 antibody
    • PCBP1_HUMAN antibody
    • poly(rC) binding protein 1 antibody
    • Poly(rC)-binding protein 1 antibody
    • rCbinding protein 1 antibody
    see all

Images

  • All lanes : Anti-PCBP1 antibody [AT2A10] (ab180256) at 1/500 dilution

    Lane 1 : HeLa lysate
    Lane 2 : HepG2 lysate

    Lysates/proteins at 40 µg per lane.

    Secondary
    goat anti-mouse secondary antibody conjugated to HRP
    Developed using the ECL technique

    Predicted band size : 37 kDa

References

ab180256 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180256.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up