Overview

  • Product name
  • Description
    Mouse polyclonal to PCDH10
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human PCDH10 aa 1-1040.
    Sequence:

    MIVLLLFALLWMVEGVFSQLHYTVQEEQEHGTFVGNIAEDLGLDITKLSA RGFQTVPNSRTPYLDLNLETGVLYVNEKIDREQICKQSPSCVLHLEVFLE NPLELFQVEIEVLDINDNPPSFPEPDLTVEISESATPGTRFPLESAFDPD VGTNSLRDYEITPNSYFSLDVQTQGDGNRFAELVLEKPLDREQQAVHRYV LTAVDGGGGGGVGEGGGGGGGAGLPPQQQRTGTALLTIRVLDSNDNVPAF DQPVYTVSLPENSPPGTLVIQLNATDPDEGQNGEVVYSFSSHISPRAREL FGLSPRTGRLEVSGELDYEESPVYQVYVQAKDLGPNAVPAHCKVLVRVLD ANDNAPEISFSTVKEAVSEGAAPGTVVALFSVTDRDSEENGQVQCELLGD VPFRLKSSFKNYYTIVTEAPLDREAGDSYTLTVVARDRGEPALSTSKSIQ VQVSDVNDNAPRFSQPVYDVYVTENNVPGAYIYAVSATDRDEGANAQLAY SILECQIQGMSVFTYVSINSENGYLYALRSFDYEQLKDFSFQVEARDAGS PQALAGNATVNILIVDQNDNAPAIVAPLPGRNGTPAREVLPRSAEPGYLL TRVAAVDADDGENARLTYSIVRGNEMNLFRMDWRTGELRTARRVPAKRDP QRPYELVIEVRDHGQPPLSSTATLVVQLVDGAVEPQGGGGSGGGGSGEHQ RPSRSGGGETSLDLTLILIIALGSVSFIFLLAMIVLAVRCQKEKKLNIYT CLASDCCLCCCCCGGGGSTCCGRQARARKKKLSKSDIMLVQSSNVPSNPA QVPIEESGGFGSHHHNQNYCYQVCLTPESAKTDLMFLKPCSPSRSTDTEH NPCGAIVTGYTDQQPDIISNGSILSNETKHQRAELSYLVDRPRRVNSSAF QEADIVSSKDSGHGDSEQGDSDHDATNRAQSAGMDLFSNCTEECKALGHS DRCWMPSFVPSDGRQAADYRSNLHVPGMDSVPDTEVFETPEAQPGAERSF STFGKEKALHSTLERKELDGLLTNTRAPYKPPYLTRKRIC


    Database link: NP_116586.1

  • Positive control
    • PCDH10 transfected 293T cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab172709 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 113 kDa.

Target

  • Function
    Potential calcium-dependent cell-adhesion protein.
  • Tissue specificity
    Moderately expressed in all regions of the brain examined, as well as in testis and ovary, and low expression in all other tissues tested.
  • Sequence similarities
    Contains 6 cadherin domains.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • DKFZp761O2023 antibody
    • KIAA1400 antibody
    • MGC133344 antibody
    • OL PCDH antibody
    • Ortholog of OL pcdh antibody
    • OTTHUMP00000220001 antibody
    • PCD10_HUMAN antibody
    • PCDH10 antibody
    • PCDH19 antibody
    • Protocadherin 10 antibody
    • Protocadherin-10 antibody
    see all

Images

  • All lanes : Anti-PCDH10 antibody (ab172709) at 1 µg/ml

    Lane 1 : PCDH10 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique

    Predicted band size : 113 kDa

References

ab172709 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172709.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up