Overview

  • Product nameAnti-PCDH11X antibody
    See all PCDH11X primary antibodies
  • Description
    Rabbit polyclonal to PCDH11X
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 446-495 (

    LNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADS

    ) of Mouse PCDH11X (NP_001074854).

  • Positive control
    • Mouse brain lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab116277 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 147 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionPotential calcium-dependent cell-adhesion protein.
  • Tissue specificityExpressed strongly in fetal brain and brain (cortex, amygdala, thalamus, substantia nigra, hippocampus, caudate nucleus and corpus callosum). Expressed at low level in testis.
  • Sequence similaritiesContains 7 cadherin domains.
  • Cellular localizationCell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • PC11X_HUMAN antibody
    • PCDH-X antibody
    • PCDH11 antibody
    • PCDH11X antibody
    • PCDHX antibody
    • PPP1R119 antibody
    • Protein phosphatase 1 regulatory subunit 119 antibody
    • Protocadherin 11X antibody
    • Protocadherin on the X chromosome antibody
    • Protocadherin-11 antibody
    • Protocadherin-11 X-linked antibody
    • Protocadherin-S antibody
    see all

Anti-PCDH11X antibody images

  • Anti-PCDH11X antibody (ab116277) at 1 µg/ml + Mouse brain lysate at 10 µg

    Predicted band size : 147 kDa

References for Anti-PCDH11X antibody (ab116277)

ab116277 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116277.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"