Overview

  • Product nameAnti-PCNA antibody
    See all PCNA primary antibodies
  • Description
    Rabbit polyclonal to PCNA
  • Tested applicationsSuitable for: ICC/IF, IHC-Fr, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human PCNA aa 1-261.
    Sequence:

    MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQL TLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLA LVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRD LSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMN EPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYY LAPKIEDEEGS


    Database link: P12004

  • Positive control
    • Tonsil, lymph node, or small intestine IF/ICC: MCF7 cell line. WB positive control 293 cell lysate Raji cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab15497 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 5 µg/ml.
IHC-Fr Use at an assay dependent concentration. Fix with acetone.
WB Use a concentration of 1 µg/ml. Detects a band of approximately 29 kDa (predicted molecular weight: 29 kDa).
IHC-P 1/100.

No special pretreatment required but maybe performed for optimum results in immunohistochemical staining of formalin/paraffin tissues.

Target

  • FunctionThis protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2.
  • Sequence similaritiesBelongs to the PCNA family.
  • Post-translational
    modifications
    Upon methyl methanesulfonate-induced DNA damage, mono-ubiquitinated by the UBE2B-RAD18 complex on Lys-164. This induces non-canonical polyubiquitination on Lys-164 through 'Lys-63' linkage of ubiquitin moieties by the E2 complex UBE2N-UBE2V2 and the E3 ligases, HLTF, RNF8 and SHPRH, which is required for DNA repair. 'Lys-63' polyubiquitination prevents genomic instability on DNA damage. Monoubiquitination at Lys-164 also takes place in undamaged proliferating cells, and is mediated by the DCX(DTL) complex, leading to enhance PCNA-dependent translesion DNA synthesis.
    Acetylated in response to UV irradiation. Acetylation disrupts interaction with NUDT15 and promotes degradation.
  • Cellular localizationNucleus. Forms nuclear foci representing sites of ongoing DNA replication and vary in morphology and number during S phase. Together with APEX2, is redistributed in discrete nuclear foci in presence of oxidative DNA damaging agents.
  • Information by UniProt
  • Database links
  • Alternative names
    • ATLD2 antibody
    • cb16 antibody
    • Cyclin antibody
    • DNA polymerase delta auxiliary protein antibody
    • etID36690.10 antibody
    • fa28e03 antibody
    • fb36g03 antibody
    • HGCN8729 antibody
    • MGC8367 antibody
    • Mutagen-sensitive 209 protein antibody
    • OTTHUMP00000030189 antibody
    • OTTHUMP00000030190 antibody
    • PCNA antibody
    • Pcna/cyclin antibody
    • PCNA_HUMAN antibody
    • PCNAR antibody
    • Polymerase delta accessory protein antibody
    • Proliferating cell nuclear antigen antibody
    • wu:fa28e03 antibody
    • wu:fb36g03 antibody
    see all

Anti-PCNA antibody images

  • ab15497/ab> staining PCNA in Human tonsil tissue (ab29614) by Immunohistochemisty (Formalin/PFA-fixed paraffin-embedded sections).

  • ICC/IF image of ab15497/ab> stained MCF7 cells. The cells were 100% methanol fixed (5 min) and then incubated in 1%BSA / 10% normal goat serum (ab7481) / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab15497/ab>, 5µg/ml) overnight at +4°C. The secondary antibody (green) was ab96899, DyLight® 488 goat anti-rabbit IgG(H+L) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

  • Anti-PCNA antibody (ab15497) at 1/1000 dilution + Mouse heart tissue lysate at 30 µg

    Secondary
    HRP-conjugated Goat anti-rabbit IgG polyclonal at 1/4000 dilution
    Developed using the ECL technique

    Performed under reducing conditions.

    Predicted band size : 29 kDa
    Observed band size : 30 kDa (why is the actual band size different from the predicted?)


    Exposure time : 2 minutes

    This image is courtesy of an anonymous Abreview

    See Abreview

  • All lanes : Anti-PCNA antibody (ab15497) at 1 µg/ml

    Lane 1 : HeLa (Human epithelial carcinoma cell line) Nuclear Lysate
    Lane 2 : HeLa (Human epithelial carcinoma cell line) Whole Cell Lysate

    Lysates/proteins at 20 µg per lane.

    Secondary
    IRDye 680 conjugated goat anti-rabbit IgG (H&L) at 1/15000 dilution

    Predicted band size : 29 kDa
  • Anti-PCNA antibody (ab15497) at 1/25 dilution + Raji cell lysate

    Predicted band size : 29 kDa
    Observed band size : 29 kDa

References for Anti-PCNA antibody (ab15497)

This product has been referenced in:
  • Xu R  et al. Controlled water vapor transmission rate promotes wound-healing via wound re-epithelialization and contraction enhancement. Sci Rep 6:24596 (2016). WB, IHC-P ; Mouse . Read more (PubMed: 27086569) »
  • Xu R  et al. Novel bilayer wound dressing composed of silicone rubber with particular micropores enhanced wound re-epithelialization and contraction. Biomaterials 40:1-11 (2015). Read more (PubMed: 25498800) »

See all 12 Publications for this product

Product Wall

Thank you for confirming these details and for your cooperation. The details provided enable us to closely monitor the quality of our products.

I am sorry this product did not perform as stated on the datasheet and for the inconvenience this...

Read More

Thank you for your enquiry. I hope this information helps, please do not hesitate to contact us if you need any more advice or information, I'm sorry to hear you are having a problem with ab15497. I would like to suggest the following modificati...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"