Anti-PCTAIRE2 antibody - C-terminal (ab186914)

Overview

  • Product name
    Anti-PCTAIRE2 antibody - C-terminal
    See all PCTAIRE2 primary antibodies
  • Description
    Rabbit polyclonal to PCTAIRE2 - C-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human PCTAIRE2 aa 474-523 (C terminal). The exact sequence is proprietary. (NP_002586).
    Sequence:

    RSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF


    Database link: Q00537

  • Positive control
    • 293T whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab186914 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 60 kDa.

Target

  • Function
    May play a role in terminally differentiated neurons. Has a Ser/Thr-phosphorylating activity for histone H1.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • 6430598J10Rik antibody
    • CDK17 antibody
    • CDK17_HUMAN antibody
    • Cell division protein kinase 17 antibody
    • Cyclin-dependent kinase 17 antibody
    • EC 2.7.1.37 antibody
    • MGC25109 antibody
    • PCTAIRE-motif protein kinase 2 antibody
    • PCTK2 antibody
    • Protein kinase cdc2-related PCTAIRE-2 antibody
    • Serine/threonine-protein kinase PCTAIRE-2 antibody
    see all

Images

  • Anti-PCTAIRE2 antibody - C-terminal (ab186914) at 1 µg/ml + 293T whole cell lysate at 10 µg

    Predicted band size : 60 kDa

References

ab186914 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186914.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up