Overview

  • Product name
  • Description
    Rabbit polyclonal to PD-L2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Cynomolgus monkey, Rhesus monkey
  • Immunogen

    Full length protein corresponding to Human PD-L2 aa 1-273.
    Sequence:

    MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHV NLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQY QCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVELTCQATGYPL AEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVR ELTLASIDLQSQMEPRTHPTWLLHIFIPSCIIAFIFIATVIALRKQLCQK LYSSKDTTKRPVTTTKREVNSAI


    Database link: Q9BQ51

  • Positive control
    • PD-L2 transfected 293T cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer
    pH: 7.20
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab169104 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 31 kDa.

Target

  • Function
    Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production.
  • Tissue specificity
    Highly expressed in heart, placenta, pancreas, lung and liver and weakly expressed in spleen, lymph nodes and thymus.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Secreted; Cell membrane and Endomembrane system.
  • Information by UniProt
  • Database links
  • Alternative names
    • B7 dendritic cell molecule antibody
    • B7-DC antibody
    • B7DC antibody
    • bA574F11.2 antibody
    • Btdc antibody
    • Butyrophilin B7 DC antibody
    • Butyrophilin B7-DC antibody
    • Butyrophilin B7DC antibody
    • CD 273 antibody
    • CD273 antibody
    • CD273 antigen antibody
    • MGC142238 antibody
    • MGC142240 antibody
    • PD 1 ligand 2 antibody
    • PD L2 antibody
    • PD-1 ligand 2 antibody
    • PD-L2 antibody
    • PD1 ligand 2 antibody
    • PD1L2_HUMAN antibody
    • PDCD 1 ligand 2 antibody
    • PDCD1 ligand 2 antibody
    • PDCD1L2 antibody
    • Pdcd1lg2 antibody
    • PDL 2 antibody
    • PDL2 antibody
    • Programmed cell death 1 ligand 2 antibody
    • Programmed death ligand 2 antibody
    see all

Images

  • All lanes : Anti-PD-L2 antibody (ab169104) at 1 µg/ml

    Lane 1 : B7 DC-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    Goat Anti-Rabbit IgG (H+L)-HRP at 1/7500 dilution
    Developed using the ECL technique

    Predicted band size : 31 kDa

References

ab169104 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169104.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up