Overview

  • Product name
  • Description
    Rabbit polyclonal to PD1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PD1 aa 41-132. (Expressed in E.coli).
    Sequence:

    LLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPG QDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKA


    Database link: Q15116

  • Positive control
    • IHC-P: Human stomach and lung cancer tissue. WB: Recombinant human PD1 protein; Pig lymph node lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab233117 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 32 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function
    Possible cell death inducer, in association with other factors.
  • Involvement in disease
    Genetic variation in PDCD1 is associated with susceptibility to systemic lupus erythematosus type 2 (SLEB2) [MIM:605218]. Systemic lupus erythematosus is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system.
  • Sequence similarities
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Developmental stage
    Induced at programmed cell death.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD279 antibody
    • CD279 antigen antibody
    • hPD 1 antibody
    • hPD l antibody
    • hPD-1 antibody
    • hSLE1 antibody
    • PD 1 antibody
    • PD-1 antibody
    • PD1 antibody
    • PDCD 1 antibody
    • PDCD1 antibody
    • PDCD1_HUMAN antibody
    • Programmed cell death 1 antibody
    • Programmed cell death 1 protein antibody
    • Programmed cell death protein 1 antibody
    • Protein PD 1 antibody
    • Protein PD-1 antibody
    • SLEB2 antibody
    • Systemic lupus erythematosus susceptibility 2 antibody
    see all

Images

  • Anti-PD1 antibody (ab233117) at 2 µg/ml + Recombinant human PD1 protein.

    Predicted band size: 32 kDa

  • Anti-PD1 antibody (ab233117) at 5 µg/ml + Pig lymph node tissue lysate.

    Predicted band size: 32 kDa

  • Formalin-fixed, paraffin-embedded human lung cancer tissue stained for PD1 using ab233117 at 20µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for PD1 using ab233117 at 20µg/mL in immunohistochemical analysis. DAB staining.

References

ab233117 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233117.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up