Overview

  • Product nameAnti-PDE12 antibody
    See all PDE12 primary antibodies
  • Description
    Rabbit polyclonal to PDE12
  • Tested applicationsSuitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 560-609 (

    LDYIFIDLNALEVEQVIPLPSHEEVTTHQALPSVSHPSDHIALVCDLKWK

    ) of Human PDE12 (NP_808881).

  • Positive control
    • OVCAR-3 cell lysate This antibody gave a positive result when used in the following formaldehyde fixed cell lines: HepG2.

Properties

Applications

Our Abpromise guarantee covers the use of ab87738 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 67 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • FunctionEnzyme that cleaves 2',5'-phosphodiester bond linking adenosines of the 5'-triphosphorylated oligoadenylates, triphosphorylated oligoadenylates referred as 2-5A modulates the 2-5A system. This enzyme degraded triphosphorylated 2-5A to produce AMP and ATP. Also cleaves 3',5'-phosphodiester bond of oligoadenylates. Play a role as a negative regulator of the The 2-5A system that is one of the major pathways for antiviral and antitumor functions induced by interferons (IFNs). Suppression of this enzyme induces reduction of viral replication in Hela cells, thus counteracting the antiviral pathway probably by inhibiting the 2-5A system.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the CCR4/nocturin family.
  • Information by UniProt
  • Database links
  • Alternative names
    • 2 PDE antibody
    • 2' 5' phosphodiesterase 12 antibody
    • 2' phosphodiesterase antibody
    • 2',5'-phosphodiesterase 12 antibody
    • 2'-PDE antibody
    • 2-PDE antibody
    • 2PDE antibody
    • DKFZp667B1218 antibody
    • Pde12 antibody
    • PDE12_HUMAN antibody
    • Phosphodiesterase 12 antibody
    see all

Anti-PDE12 antibody images

  • ICC/IF image of ab87738 stained HepG2 cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody ab87738 at 10µg/ml overnight at +4°C. The secondary antibody (pseudo-colored green) was Alexa Fluor® 488 goat anti- rabbit (ab150081) IgG (H+L) preadsorbed, used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (pseudo-colored red) at a 1/200 dilution for 1h at room temperature. DAPI was used to stain the cell nuclei (pseudo-colored blue) at a concentration of 1.43µM for 1hour at room temperature.

  • Anti-PDE12 antibody (ab87738) at 1 µg/ml (in 5% skim milk / PBS buffer) + OVCAR-3 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 67 kDa
    Observed band size : 65 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 38 kDa,45 kDa. We are unsure as to the identity of these extra bands.
    Gel concentration: 12%

References for Anti-PDE12 antibody (ab87738)

This product has been referenced in:
  • Li L  et al. Hydrolysis of 2'3'-cGAMP by ENPP1 and design of nonhydrolyzable analogs. Nat Chem Biol 10:1043-8 (2014). Read more (PubMed: 25344812) »
  • Rorbach J  et al. PDE12 removes mitochondrial RNA poly(A) tails and controls translation in human mitochondria. Nucleic Acids Res : (2011). WB ; Human . Read more (PubMed: 21666256) »

See all 2 Publications for this product

Product Wall

There are currently no Abreviews or Questions for ab87738.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"