Anti-PDE4D antibody - C-terminal (ab182351)

Overview

  • Product name
    Anti-PDE4D antibody - C-terminal
    See all PDE4D primary antibodies
  • Description
    Rabbit polyclonal to PDE4D - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide within Human PDE4D aa 432-481 (C terminal). The exact sequence is proprietary.
    Sequence:

    FQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQ


    Database link: Q08499-5

  • Positive control
    • Human thymus tumor lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab182351 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 58 kDa.

Target

  • Function
    Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes.
  • Tissue specificity
    Widespread; most abundant in skeletal muscle. Isoform 6 is detected in brain. Isoform 8 is detected in brain, placenta, lung and kidney. Isoform 7 is detected in heart and skeletal muscle.
  • Pathway
    Purine metabolism; 3',5'-cyclic AMP degradation; AMP from 3',5'-cyclic AMP: step 1/1.
  • Involvement in disease
    Note=Genetic variations in PDE4D might be associated with susceptibility to stroke. PubMed:17006457 states that association with stroke has to be considered with caution.
  • Sequence similarities
    Belongs to the cyclic nucleotide phosphodiesterase family. PDE4 subfamily.
  • Post-translational
    modifications
    Isoform 3 and isoform 7 are activated by phosphorylation (in vitro), but not isoform 6. Isoform N3 and isoform 12 are phosphorylated on Ser-49, Ser-51, Ser-55 and Ser-59.
  • Cellular localization
    Cytoplasm. Membrane. Cytoplasm > cytoskeleton. Cytoplasm > cytoskeleton > centrosome. Found in the soluble fraction, associated with membranes, and associated with the cytoskeleton and the centrosome.
  • Information by UniProt
  • Database links
  • Alternative names
    • cAMP specific 3',5' cyclic phosphodiesterase 4D antibody
    • DKFZp686M11213 antibody
    • 5''-cyclic phosphodiesterase 4D antibody
    • cAMP specific phosphodiesterase 4D antibody
    • cAMP specific phosphodiesterase PDE4D6 antibody
    • cAMP-specific 3'' antibody
    • DPDE3 antibody
    • Dunce like phosphodiesterase E3 antibody
    • FLJ97311 antibody
    • HSPDE4D antibody
    • PDE43 antibody
    • Pde4d antibody
    • PDE4D_HUMAN antibody
    • PDE4DN2 antibody
    • Phosphodiesterase 4D cAMP specific (dunce (Drosophila) homolog phosphodiesterase E3) antibody
    • Phosphodiesterase 4D cAMP specific (phosphodiesterase E3 dunce homolog Drosophila) antibody
    • Phosphodiesterase 4D cAMP specific antibody
    • Phosphodiesterase 4D, cAMP specific (dunce) antibody
    • STRK1 antibody
    see all

Images

  • Anti-PDE4D antibody - C-terminal (ab182351) at 1 µg/ml + Human thymus tumor lysate at 10 µg

    Predicted band size: 58 kDa

References

ab182351 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abcam has not validated the combination of species/application used in this Abreview.
Application
Western blot
Sample
Mouse Tissue lysate - whole (Heart)
Gel Running Conditions
Reduced Denaturing (4-15% gradient)
Loading amount
80 µg
Specification
Heart
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C
Username

Abcam user community

Verified customer

Submitted Jun 05 2018

Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunoprecipitation
Sample
Human Cell lysate - other (Purified recombinant protein)
Total protein in input
0.1 µg
Immuno-precipitation step
Protein A/G
Specification
Purified recombinant protein
Username

Abcam user community

Verified customer

Submitted May 24 2018

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up