Overview

  • Product nameAnti-PDE7B antibody
    See all PDE7B primary antibodies
  • Description
    Rabbit polyclonal to PDE7B
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 251-300 (IGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLH N) of Human PDE7B (NP_061818).

  • Positive control
    • MCF7 cell line.

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab98094 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevancePDE7B is a cAMP specific phosphodiesterase. The cAMP-specific phosphodiesterase type-7 (PDE7) family is comprised of 2 genes (PDE7A and PDE7B) each with multiple splice variants generated by RNA splicing and use of alternate initiation sites. PDE7B has three splice variants (PDE7B1 = 446 amino acid; PDE7B2 =359 amino acids and PDE7B3 = 459 amino acids. Both PDE7B2 ad PDE7B3 posses unique N-terminal sequences. PDE7B is expressed in various tissues including skeletal muscle, heart, lung and testis. PDE7B may be involved in the control of cAMP-mediated neural activity and cAMP metabolism in the brain.
  • Cellular localizationcytosol
  • Database links
  • Alternative names
    • bA472E5.1 antibody
    • cAMP specific 3 5 cyclic phosphodiesterase 7B antibody
    • cAMP specific 3'5' cyclic phosphodiesterase 7B antibody
    • High affinity cAMP specific 3 5 cyclic phosphodiesterase antibody
    • High affinity cAMP specific 3'5' cyclic phosphodiesterase antibody
    • MGC88256 antibody
    • OTTHUMP00000017267 antibody
    • PDE 7B antibody
    • PDE7B protein antibody
    • Phosphodiesterase 7B antibody
    • Phosphodiesterase7B antibody
    • RNPDE7B antibody
    • Rolipram insensitive phosphodiesterase type 7 antibody
    see all

Anti-PDE7B antibody images

  • Anti-PDE7B antibody (ab98094) at 1 µg/ml + MCF7 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG diluted between 1/50,000 - 1/100,000

    Predicted band size : 52 kDa

References for Anti-PDE7B antibody (ab98094)

ab98094 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98094.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"