Overview

  • Product name
  • Description
    Rabbit polyclonal to PDLIM7
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Turkey, Chimpanzee, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide: Corresponding to a region between the C terminal residues 407 and 457 of human LIM mineralization protein 1: IDAGDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKDRPLCKSHAFSH V

  • Positive control
    • HeLa whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab86069 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 50 kDa.
IP Use at 2-5 µg/mg of lysate.

Target

  • Function
    May function as a scaffold on which the coordinated assembly of proteins can occur. May play a role as an adapter that, via its PDZ domain, localizes LIM-binding proteins to actin filaments of both skeletal muscle and nonmuscle tissues. Involved in both of the two fundamental mechanisms of bone formation, direct bone formation (e.g. embryonic flat bones mandible and cranium), and endochondral bone formation (e.g. embryonic long bone development). Plays a role during fracture repair. Involved in BMP6 signaling pathway.
  • Tissue specificity
    Isoform 1 and isoform 2 are expressed ubiquitously, however, isoform 2 predominates in skeletal muscle, isoform 1 is more abundant in lung, spleen, leukocytes and fetal liver.
  • Sequence similarities
    Contains 3 LIM zinc-binding domains.
    Contains 1 PDZ (DHR) domain.
  • Domain
    The LIM zinc-binding 2 (LIM 2) domain interacts with TBX4.
    The LIM zinc-binding 3 (LIM 3) domain provides the structural basis for recognition of tyrosine-containing tight turn structures. This domain is necessary and sufficient for interaction with TBX5.
    Anchored to cell periphery via its N-terminal PDZ domain.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton. Colocalizes with RET to the cell periphery and in some cytoskeletal components. Colocalizes with TPM2 near the Z line in muscle. Co-localizes with TBX4 and TBX5 to actin filaments.
  • Information by UniProt
  • Database links
  • Alternative names
    • 1110003B01Rik antibody
    • Enigma antibody
    • LIM domain protein antibody
    • LIM domain protein enigma antibody
    • LIM mineralization protein 1 antibody
    • Lim mineralization protein 3 antibody
    • LIM mineralization protein antibody
    • LMP 1 antibody
    • LMP antibody
    • LMP1 antibody
    • LMP3 antibody
    • PDLI7_HUMAN antibody
    • PDLIM 7 antibody
    • Pdlim7 antibody
    • PDZ and LIM doamin protein 7 antibody
    • PDZ and LIM domain 7 antibody
    • PDZ and LIM domain protein 7 antibody
    • Protein enigma antibody
    see all

Images

  • All lanes : Anti-PDLIM7 antibody (ab86069) at 0.04 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : HeLa whole cell lysate at 5 µg

    Developed using the ECL technique

    Predicted band size : 50 kDa


    Exposure time : 3 minutes

References

ab86069 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab86069.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up