Overview

  • Product name
  • Description
    Rabbit polyclonal to PDXDC1
  • Tested applications
    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human PDXDC1 aa 11-61.
    Sequence:

    PTLAEMGKNLKEAVKMLEDSQRRTEEENGKKLISRDIPGPLQGSGQDMVS I


    Database link: Q6P996

  • Positive control
    • Human colon tissue; RT-4 cell lysates; Human U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab187971 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.
WB 1/100 - 1/250. Predicted molecular weight: 87 kDa.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded Human colon tissue labeling PDXDC1 with ab187971 at 1/200 dilution.

  • Anti-PDXDC1 antibody (ab187971) at 1/100 dilution + RT-4 cell lysates

    Predicted band size : 87 kDa
  • Immunofluorescence analysis of Human cell line U-2 OS labeling PDXDC1 with ab187971 at 4 µg/ml.

References

ab187971 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187971.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up