Anti-PDZRN3 antibody - N-terminal (ab179672)

Overview

  • Product name
    Anti-PDZRN3 antibody - N-terminal
  • Description
    Rabbit Polyclonal to PDZRN3 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Guinea pig, Cow
  • Immunogen

    Synthetic peptide within Human SEMCAP3 aa 4-53 (N terminal). The exact sequence is proprietary.
    Sequence:

    ELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCP


    Database link: Q9UPQ7-3

  • Positive control
    • Human fetal thymus lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab179672 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 80 kDa.

Target

  • Function
    E3 ubiquitin-protein ligase. Plays an important role in regulating the surface level of MUSK on myotubes. Mediates the ubiquitination of MUSK, promoting its endocytosis and lysosomal degradation. Might contribute to terminal myogenic differentiation.
  • Tissue specificity
    Widely expressed, including in the heart, skeletal muscle and liver and, at lower levels, in the brain, colon, small intestine, placenta and lung. Down-regulated in ovarian serous papillary tumors.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 2 PDZ (DHR) domains.
    Contains 1 RING-type zinc finger.
    Contains 1 TRAF-type zinc finger.
  • Domain
    The RING-type zinc finger domain is required for E3 ligase activity.
  • Post-translational
    modifications
    Auto-ubiquitinated.
  • Information by UniProt
  • Database links
  • Alternative names
    • E3 ubiquitin-protein ligase PDZRN3 antibody
    • KIAA1095 antibody
    • Ligand of Numb protein X 3 antibody
    • likely ortholog of mouse semaF cytoplasmic domain associated protein 3 antibody
    • LNX3 antibody
    • PDZ domain containing ring finger 3 antibody
    • PDZ domain-containing RING finger protein 3 antibody
    • Pdzrn3 antibody
    • Protein SEMACAP3 antibody
    • PZRN3_HUMAN antibody
    • SEMACAP3 antibody
    • Semaphorin cytoplasmic domain associated protein antibody
    • Semaphorin cytoplasmic domain-associated protein 3 antibody
    • SEMCAP3 antibody
    see all

Images

  • Anti-PDZRN3 antibody - N-terminal (ab179672) at 1 µg/ml + Human fetal thymus lysate at 10 µg

    Predicted band size: 80 kDa

References

ab179672 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179672.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up