Overview

  • Product name
    Anti-Pepsin antibody (Biotin)
    See all Pepsin primary antibodies
  • Description
    Goat polyclonal to Pepsin (Biotin)
  • Conjugation
    Biotin
  • Tested applications
    Suitable for: IHC-P, WB, ELISAmore details
  • Species reactivity
    Reacts with: Pig
  • Immunogen

    Full length native protein (purified) corresponding to Pig Pepsin aa 1-385. Purified from Pig stomach.
    Sequence:

    MKWLLLLSLVVLSECLVKVPLVRKKSLRQNLIKNGKLKDFLKTHKHNPAS KYFPEAAALIGDEPLENYLDTEYFGTIGIGTPAQDFTVIFDTGSSNLWVP SVYCSSLACSDHNQFNPDDSSTFEATSQELSITYGTGSMTGILGYDTVQV GGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISASGATPVFDNLW DQGLVSQDLFSVYLSSNDDSGSVVLLGGIDSSYYTGSLNWVPVSVEGYWQ ITLDSITMDGETIACSGGCQAIVDTGTSLLTGPTSAIANIQSDIGASENS DGEMVISCSSIDSLPDIVFTINGVQYPLSPSAYILQDDDSCTSGFEGMDV PTSSGELWILGDVFIRQYYTVFDRANNKVGLAPVA


    Database link: P00791

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Store In the Dark.
  • Storage buffer
    pH: 7.2
    Preservative: 0.01% Sodium azide
    Constituents: 0.27% Potassium phosphate, 0.88% Sodium chloride, 1% BSA
  • Concentration information loading...
  • Purity
    IgG fraction
  • Purification notes
    ab181677 is an IgG fraction antibody purified from monospecific antiserum by a multi-step process which includes delipidation, salt fractionation and ion exchange chromatography followed by extensive dialysis against the buffer stated.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab181677 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB 1/500 - 1/2000. Predicted molecular weight: 41 kDa.
ELISA 1/3000 - 1/15000.

Target

  • Relevance
    Pepsin is a digestive enzyme with particularly broad specificity. It is stored as pepsinogen, so only released when needed. In the stomach, chief cells release pepsinogen. The hormone gastrin and the vagus nerve trigger the release of both pepsinogen and HCl from the stomach lining when food is ingested. HCl creates an acidic environment which allows pepsinogen to unfold and cleave itself in an autocatalytic fashion, thereby generating pepsin (the active form). Pepsin may then cleave the dietary proteins into smaller peptides.
  • Cellular localization
    Secreted
  • Database links
  • Alternative names
    • Pepsin A 3 antibody
    • Pepsin A 4 antibody
    • Pepsin A 5 antibody
    • Pepsin A antibody
    • Pepsin antibody
    • Pepsinogen 3 antibody
    • Pepsinogen 4 antibody
    • Pepsinogen 5 antibody
    • Pepsinogen antibody
    • PGA antibody
    • PGA3 antibody
    • PGA4 antibody
    • PGA5 antibody
    see all

References

ab181677 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181677.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up