Overview

  • Product name
  • Description
    Rabbit polyclonal to Peptide YY
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human Peptide YY aa 35-84.
    Sequence:

    APREDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGED


    Database link: P10082

  • Positive control
    • Human fetal thymus lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab99026 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 11 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-Peptide YY antibody (ab99026) at 1 µg/ml + Human fetal thymus lysate at 10 µg

    Secondary

    Developed using the ECL technique

    Predicted band size : 11 kDa

References

ab99026 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99026.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up