Overview

  • Product nameAnti-Peptide YY antibody
    See all Peptide YY primary antibodies
  • Description
    Rabbit polyclonal to Peptide YY
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human Peptide YY aa 35-84.
    Sequence:

    APREDASPEELNRYYASLRHYLNLVTRQRYGKRDGPDTLLSKTFFPDGED


    Database link: P10082

  • Positive control
    • Human fetal thymus lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab99026 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 11 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-Peptide YY antibody images

  • Anti-Peptide YY antibody (ab99026) at 1 µg/ml + Human fetal thymus lysate at 10 µg

    Secondary

    Developed using the ECL technique

    Predicted band size : 11 kDa

References for Anti-Peptide YY antibody (ab99026)

ab99026 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99026.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"