• Product nameAnti-Pet1 antibody
    See all Pet1 primary antibodies
  • Description
    Rabbit polyclonal to Pet1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Drosophila melanogaster
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 35-84 (PLSPAVQKGSGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEV A) of Human Pet1 (NP_059991).

  • Positive control
    • HeLa cell line lysate


Associated products


Our Abpromise guarantee covers the use of ab108265 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 25 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • FunctionFunctions as a transcriptional regulator. According to PubMed:12761502, it functions as a transcriptional repressor. Functions in the differentiation and the maintenance of the central serotonergic neurons. May play a role in cell growth.
  • Tissue specificityIn brain, exclusively expressed in the major serotonergic neurons of the dorsal and median raphe nuclei located in the midbrain and pons. Also detected in prostate and small intestine.
  • Involvement in diseaseGenetic variation in FEV may be associated with susceptibility to sudden infant death syndrome (SIDS) [MIM:272120]. SIDS remains elusive in its causes and devastating in its consequences. Despite the impressive decline in the incidence of SIDS since the recommendation to avoid the prone sleep position, SIDS remains a leading cause of death in the first year of life.
    Note=A chromosomal aberration involving FEV is found in Ewing tumors. Translocation t(2;21;22)(q23;q22;q12) that forms a EWSR1-FEV fusion protein with a potential oncogenic activity.
  • Sequence similaritiesBelongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • ETS-domain transcription factor antibody
    • FEV (ETS oncogene family) antibody
    • FEV antibody
    • FEV_HUMAN antibody
    • Fifth Ewing sarcoma variant antibody
    • Fifth Ewing variant protein antibody
    • HSRNAFEV antibody
    • mPet1 antibody
    • PC12 ETS domain-containing transcription factor 1 antibody
    • PC12 ETS factor 1 antibody
    • Pet-1 antibody
    • Protein FEV antibody
    see all

Anti-Pet1 antibody images

  • Anti-Pet1 antibody (ab108265) at 1 µg/ml + HeLa cell line lysate at 10 µg

    Predicted band size : 25 kDa

References for Anti-Pet1 antibody (ab108265)

ab108265 has not yet been referenced specifically in any publications.

Product Wall

Thank you very much for your interest in ab108265 Anti-PET 1 antibody. To our knowledge this product has not been tested in rat. However a BLAST of the immunogen used showed 100% identity with rat. NP_653354.2Score = 106 bits (265), Expect = 3e-27,...

Read More