Overview

  • Product name
    Anti-PFAS antibody - N-terminal
    See all PFAS primary antibodies
  • Description
    Rabbit polyclonal to PFAS - N-terminal
  • Tested applications
    Suitable for: IP, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human PFAS aa 1-50 (N terminal). The exact sequence is proprietary. (NP_036525.1).
    Sequence:

    MSPVLHFYVRPSGHEGAAPGHTRRKLQGKLPELQGVETELCYNVNWTAEA


    Database link: O15067

  • Positive control
    • Jurkat, HeLa and 293T whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab186048 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/500 - 1/2500. Predicted molecular weight: 145 kDa.

Target

  • Relevance
    Purines are necessary for many cellular processes, including DNA replication, transcription, and energy metabolism. Ten enzymatic steps are required to synthesize inosine monophosphate (IMP) in the de novo pathway of purine biosynthesis. PFAS catalyzes the fourth step of IMP biosynthesis.
  • Cellular localization
    Cytoplasmic
  • Database links
  • Alternative names
    • PFAS antibody
    • FGAM synthase antibody
    • FGAMS antibody
    • FGAR amidotransferase antibody
    • FGARAT antibody
    • Formylglycinamide ribotide amidotransferase antibody
    • Formylglycinamide ribotide synthetase antibody
    • KIAA0361 antibody
    • Phosphoribosylformylglycinamidine synthase antibody
    • PURL antibody
    see all

Images

  • All lanes : Anti-PFAS antibody - N-terminal (ab186048) at 1 µg/ml

    Lane 1 : Jurkat whole cell lysate
    Lane 2 : HeLa whole cell lysate
    Lane 3 : 293T whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique

    Predicted band size : 145 kDa


    Exposure time : 3 minutes
  • Detection of PFAS in immunoprecipitates of Jurkat whole cell lysate (1 mg for IP, 20% of IP loaded) using ab186048 at 6 µg/mg lysate for IP (Lane 1) and at 1 µg/ml for subsequent Western blot detection. Lane 2 represents rabbit IgG IP control.
    Detection: Chemiluminescence with an exposure time of 3 minutes.

References

ab186048 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186048.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up