Overview

  • Product name
  • Description
    Rabbit polyclonal to PFKP
  • Tested applications
    Suitable for: IP, WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Chimpanzee, Rhesus monkey, Orangutan
  • Immunogen

    Synthetic peptide within Human PFKP aa 1-50. The exact sequence is proprietary. (NP_002618.1).
    Sequence:

    MDADDSRAPKGSLRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMG


    Database link: Q01813

  • Positive control
    • HeLa, 293T, Jurkat and NIH 3T3 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab186132 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 86 kDa.

Target

  • Pathway
    Carbohydrate degradation; glycolysis; D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose: step 3/4.
  • Sequence similarities
    Belongs to the phosphofructokinase family. Two domains subfamily.
  • Information by UniProt
  • Database links
  • Alternative names
    • 1200015H23Rik antibody
    • 6 phosphofructokinase type C antibody
    • 6 phosphofructokinase, platelet type antibody
    • 6-phosphofructokinase antibody
    • 6-phosphofructokinase type C antibody
    • 9330125N24Rik antibody
    • FLJ40226 antibody
    • K6PP antibody
    • K6PP_HUMAN antibody
    • MGC105718 antibody
    • PFK C antibody
    • PFK, fibroblast type antibody
    • PFK-C antibody
    • PFKF antibody
    • PFKP antibody
    • Phosphofructo 1 kinase isozyme C antibody
    • Phosphofructo-1-kinase isozyme C antibody
    • Phosphofructokinase 1 antibody
    • Phosphofructokinase platelet antibody
    • Phosphohexokinase antibody
    • platelet type antibody
    see all

Images

  • All lanes : Anti-PFKP antibody (ab186132) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK-1 whole cell lysate
    Lane 5 : NIH 3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique

    Predicted band size : 86 kDa


    Exposure time : 3 minutes
  • Detection of PFKP in immunoprecipitates of 293T whole cell lysate (0.5 or 1 mg for IP, 20% of IP loaded) using ab186132 at 6 µg/reaction for IP. For WB detection, ab186132 was used at 1µg/ml. 

    Detection: Chemiluminescence with an exposure time of 10 seconds.

References

ab186132 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186132.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up