Overview

  • Product nameAnti-PGA5 antibody
    See all PGA5 primary antibodies
  • Description
    Mouse monoclonal to PGA5
  • Tested applicationsSuitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PGA5 aa 203-306.
    Sequence:

    WNQGLVSQDLFSVYLSADDKSGSVVIFGGIDSSYYTGSLNWVPVTVEGYW QITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASEN SDGD


    Database link: P0DJD9

Properties

Applications

Our Abpromise guarantee covers the use of ab55612 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 42 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

Anti-PGA5 antibody images



  • Predicted band size : 42 kDa
  • ab55612 at 10 ug/ml staining PGA5 in human Hella cells by Immunocytochemistry/ Immunofluorescence.

References for Anti-PGA5 antibody (ab55612)

ab55612 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab55612.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"