Overview

  • Product nameAnti-PGAP3 antibody
    See all PGAP3 primary antibodies
  • Description
    Rabbit polyclonal to PGAP3
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 1-50 (AGLAARLVLLAGAAALASGSQGDREPVYRDCVLQCEEQNCSGGALNHFR S) of Human PGAP3 (NP_219487)

  • Positive control
    • HeLa cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab81368 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 36 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/12500.

Target

  • RelevancePGAP3 is involved in the lipid remodeling steps of GPI-anchor maturation. Lipid remodeling steps consist in the generation of 2 saturated fatty chains at the sn-2 position of GPI-anchors proteins. PGAP3 is required for phospholipase A2 activity that removes an acyl-chain at the sn-2 position of GPI-anchors during the remodeling of GPI.
  • Cellular localizationGolgi apparatus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein
  • Database links
  • Alternative names
    • AGLA546 antibody
    • CAB2 antibody
    • Gene coamplified with ERBB2 protein antibody
    • hCOS16 antibody
    • MGC9753 antibody
    • PER1 antibody
    • Per1 like domain containing 1 antibody
    • PER1 like domain containing protein 1 antibody
    • PERLD1 antibody
    • PGAP3 antibody
    • Post GPI attachment to proteins 3 antibody
    • Post GPI attachment to proteins factor 3 antibody
    • PP1498 antibody
    see all

Anti-PGAP3 antibody images

  • Anti-PGAP3 antibody (ab81368) at 1 µg/ml (in 5% skim milk / PBS buffer) + HeLa cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 36 kDa
    Observed band size : 33 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 60 kDa. We are unsure as to the identity of these extra bands.

References for Anti-PGAP3 antibody (ab81368)

ab81368 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81368.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"