Anti-PGRMC1 antibody - C-terminal (ab189848)

Overview

  • Product name
    Anti-PGRMC1 antibody - C-terminal
    See all PGRMC1 primary antibodies
  • Description
    Rabbit polyclonal to PGRMC1 - C-terminal
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Pig, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human PGRMC1 aa 44-195 (C terminal).
    Sequence:

    KIVRGDQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAI NGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLS DLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARK ND


    Database link: O00264

  • Positive control
    • HepG2, 293T, SW480, OVCAR, H460 cell extracts; Mouse liver and brain tissue extracts

Properties

Applications

Our Abpromise guarantee covers the use of ab189848 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 22 kDa.
IHC-P 1/50 - 1/200.

Target

Images

  • All lanes : Anti-PGRMC1 antibody - C-terminal (ab189848) at 1/500 dilution

    Lane 1 : HepG2 cell extract
    Lane 2 : 293T cell extract
    Lane 3 : SW480 cell extract
    Lane 4 : OVCAR cell extract
    Lane 5 : H480 cell extract
    Lane 6 : Mouse liver tissue extract
    Lane 7 : Mouse brain tissue extract


    Predicted band size : 22 kDa

References

ab189848 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189848.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up