Overview

  • Product nameAnti-PHF13 antibody
    See all PHF13 primary antibodies
  • Description
    Rabbit polyclonal to PHF13
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 35-84 (LAYAGYIPYPKEELPLRSSPSPANSTAGTIDSDGWDAGFSDIASSVPLP V) of Human PHF13 (NP_722519)

  • Positive control
    • Jurkat cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab84693 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 34 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionModulates chromatin structure. Required for normal chromosome condensation during the early stages of mitosis. Required for normal chromosome separation during mitosis.
  • Sequence similaritiesContains 1 PHD-type zinc finger.
  • Post-translational
    modifications
    Subject to proteasomal degradation. Stable when bound to chromatin. The soluble form is rapidly degraded.
  • Cellular localizationNucleus. Nucleus > nucleoplasm. Predominantly bound to chromatin, but a minor proportion is also detected in the nucleoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • MGC43399 antibody
    • OTTHUMP00000001577 antibody
    • PHD finger protein 13 antibody
    • PHD zinc finger protein PHF5 antibody
    • PHF 13 antibody
    • PHF13 antibody
    • PHF13_HUMAN antibody
    • PHF5 antibody
    • SPOC1 antibody
    • Survival time associated PHD protein in ovarian cancer antibody
    • Survival time-associated PHD finger protein in ovarian cancer 1 antibody
    see all

Anti-PHF13 antibody images

  • Anti-PHF13 antibody (ab84693) at 1 µg/ml + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 34 kDa
    Observed band size : 34 kDa

References for Anti-PHF13 antibody (ab84693)

ab84693 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84693.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"