Overview

  • Product name
  • Description
    Rabbit polyclonal to PHF19
  • Tested applications
    Suitable for: IPmore details
    Unsuitable for: WB
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide within Human PHF19 aa 475-525. The exact sequence is proprietary. (NP_056466.1).
    Sequence:

    RKLAAKAYMPLRAKRWAAELDGRCPSDSSAEGASVPERPDEGIDSHTFES I


    Database link: Q5T6S3

  • Positive control
    • Jurkat whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab176586 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
  • Application notes
    Is unsuitable for WB.
  • Target

    • Function
      Acts as a transcritpional repressor. Isoform 1 and isoform 2 inhibit transcription from an HSV-tk promoter.
    • Tissue specificity
      Isoform 1 is expressed in thymus, heart, lung and kidney. Isoform 2 is predominantly expressed in placenta, skeletal muscle and kidney, whereas isoform 1 is predominantly expressed in liver and peripheral blood leukocytes. Overexpressed in many types of cancers, including colon, skin, lung, rectal, cervical, uterus, liver cancers, in cell lines derived from different stages of melanoma and in glioma cell lines.
    • Sequence similarities
      Contains 2 PHD-type zinc fingers.
    • Cellular localization
      Nucleus.
    • Information by UniProt
    • Database links
    • Alternative names
      • hPCL3 antibody
      • MGC131698 antibody
      • MGC149712 antibody
      • MGC149713 antibody
      • MGC23929 antibody
      • MTF2L1 antibody
      • OTTHUMP00000021996 antibody
      • OTTHUMP00000021998 antibody
      • PCL3 antibody
      • PHD finger protein 19 antibody
      • Phf19 antibody
      • PHF19 protein antibody
      • PHF19_HUMAN antibody
      • Polycomb like 3 antibody
      • Polycomb like protein 3 antibody
      • Polycomb-like protein 3 antibody
      • TDRD19B antibody
      • Tudor domain containing 19B antibody
      see all

    Images

    • Detection of PHF19 in Immunoprecipitates of Jurkat whole cell lysate (1 mg for IP, 20% of IP loaded) using ab176586 at 6 µg/mg lysate for IP (Lane 1). For WB detection an anti-PHF19 antibody was used at 1 µg/ml. Lane 2 represents control IgG IP.

      Detection: Chemiluminescence with an exposure time of 30 seconds.

    References

    ab176586 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab176586.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up