Anti-Phosphate-binding protein PstS 1 antibody (FITC) (ab193393)

Overview

  • Product name
    Anti-Phosphate-binding protein PstS 1 antibody (FITC)
    See all Phosphate-binding protein PstS 1 primary antibodies
  • Description
    Rabbit polyclonal to Phosphate-binding protein PstS 1 (FITC)
  • Host species
    Rabbit
  • Conjugation
    FITC. Ex: 493nm, Em: 528nm
  • Specificity
    Reacts with Mycobacterium tuberculosis.
  • Tested applications
    Suitable for: WBmore details
  • Immunogen

    Recombinant full length protein corresponding to Phosphate-binding protein PstS 1 aa 24-374. Mycobacterium tuberculosis.
    Sequence:

    CGSKPPSGSPETGAGAGTVATTPASSPVTLAETGSTLLYPLFNLWGPAFH ERYPNVTITAQGTGSGAGIAQAAAGTVNIGASDAYLSEGDMAAHKGLMNI ALAISAQQVNYNLPGVSEHLKLNGKVLAAMYQGTIKTWDDPQIAALNPGV NLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPGFGTTVDFPAVP GALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGNF LLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQ KDAATAQTLQAFLHWAITDGNKASFLDQVHFQPLPPAVVKLSDALIATIS S


    Database link: P9WGU1

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C. Store In the Dark.
  • Storage buffer
    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab193393 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 38 kDa.

Target

  • Relevance
    Part of the ABC transporter complex PstSACB involved in phosphate import
  • Cellular localization
    Cell Membrane
  • Alternative names
    • Antigen Ag78 antibody
    • PAB antibody
    • phoS antibody
    • phoS1 antibody
    • phosphate ABC transporter substrate-binding lipoprotein PstS antibody
    • Protein antigen B antibody
    • pstS1 antibody
    see all

References

ab193393 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193393.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up