Overview

  • Product nameAnti-Phospholipase D2 antibody
    See all Phospholipase D2 primary antibodies
  • Description
    Rabbit polyclonal to Phospholipase D2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rabbit, Horse, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide (

    TATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQS

    ) corresponding to a region within the N terminal amino acids 2-51 of Human Phospholipase D2 (NP_002654)

  • Positive control
    • Transfected 293T cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab86437 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 106 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay have a role in signal-induced cytoskeletal regulation and/or endocytosis.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the phospholipase D family.
    Contains 1 PH domain.
    Contains 2 PLD phosphodiesterase domains.
    Contains 1 PX (phox homology) domain.
  • Cellular localizationMembrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Choline phosphatase 2 antibody
    • EC 3.1.4.4 antibody
    • hPLD 2 antibody
    • hPLD2 antibody
    • mPLD2 antibody
    • Phosphatidylcholine hydrolyzing phospholipase D2 antibody
    • Phosphatidylcholine-hydrolyzing phospholipase D2 antibody
    • Phospholipase D2 antibody
    • PhospholipaseD2 antibody
    • PLD 2 antibody
    • PLD1C antibody
    • Pld2 antibody
    • PLD2_HUMAN antibody
    • Pldc antibody
    • rPLD2 antibody
    see all

Anti-Phospholipase D2 antibody images

  • Anti-Phospholipase D2 antibody (ab86437) at 1 µg/ml + Transfected 293T cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 106 kDa
    Observed band size : >70 kDa (why is the actual band size different from the predicted?)

References for Anti-Phospholipase D2 antibody (ab86437)

ab86437 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab86437.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"