Overview

  • Product name
    Anti-Phospholipase D2 antibody
    See all Phospholipase D2 primary antibodies
  • Description
    Rabbit polyclonal to Phospholipase D2
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rabbit, Horse, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide (

    TATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQS

    ) corresponding to a region within the N terminal amino acids 2-51 of Human Phospholipase D2 (NP_002654)

  • Positive control
    • Transfected 293T cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab86437 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 106 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    May have a role in signal-induced cytoskeletal regulation and/or endocytosis.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the phospholipase D family.
    Contains 1 PH domain.
    Contains 2 PLD phosphodiesterase domains.
    Contains 1 PX (phox homology) domain.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Choline phosphatase 2 antibody
    • EC 3.1.4.4 antibody
    • hPLD 2 antibody
    • hPLD2 antibody
    • mPLD2 antibody
    • Phosphatidylcholine hydrolyzing phospholipase D2 antibody
    • Phosphatidylcholine-hydrolyzing phospholipase D2 antibody
    • Phospholipase D2 antibody
    • PhospholipaseD2 antibody
    • PLD 2 antibody
    • PLD1C antibody
    • Pld2 antibody
    • PLD2_HUMAN antibody
    • Pldc antibody
    • rPLD2 antibody
    see all

Images

  • Anti-Phospholipase D2 antibody (ab86437) at 1 µg/ml + Transfected 293T cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 106 kDa
    Observed band size : >70 kDa (why is the actual band size different from the predicted?)

References

ab86437 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab86437.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up