Anti-Phosphoserine phosphatase antibody (ab98186)

Overview

  • Product name
    Anti-Phosphoserine phosphatase antibody
    See all Phosphoserine phosphatase primary antibodies
  • Description
    Rabbit polyclonal to Phosphoserine phosphatase
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 175-224,

    IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE

    , of Human Phosphoserine phosphatase (NP_004568).

  • Positive control
    • Human Fetal Heart Lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab98186 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 25 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Catalyzes the last step in the biosynthesis of serine from carbohydrates. The reaction mechanism proceeds via the formation of a phosphoryl-enzyme intermediates.
  • Pathway
    Amino-acid biosynthesis; L-serine biosynthesis; L-serine from 3-phospho-D-glycerate: step 3/3.
  • Involvement in disease
    Defects in PSPH are the cause of phosphoserine phosphatase deficiency (PSPHD)[MIM:614023]. A disorder that results in pre- and postnatal growth retardation, moderate psychomotor retardation and facial features suggestive of Williams syndrome.
  • Sequence similarities
    Belongs to the SerB family.
  • Information by UniProt
  • Database links
  • Alternative names
    • EC 3.1.3.3 antibody
    • L 3 phosphoserine phosphatase antibody
    • L-3-phosphoserine phosphatase antibody
    • O phosphoserine phosphohydrolase antibody
    • O-phosphoserine phosphohydrolase antibody
    • Phosphoserine phosphatase antibody
    • Phosphoserine phosphatase deficiency, included antibody
    • PSP antibody
    • PSPase antibody
    • Psph antibody
    • PSPHD antibody
    • SERB_HUMAN antibody
    see all

Images

  • Anti-Phosphoserine phosphatase antibody (ab98186) at 1 µg/ml (n 5% skim milk / PBS buffer) + Human Fetal Heart Lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 25 kDa

References

ab98186 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab98186.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up