Overview

  • Product nameAnti-PICK1 antibody [S20-8]
    See all PICK1 primary antibodies
  • Description
    Mouse monoclonal [S20-8] to PICK1
  • Tested applicationsSuitable for: WB, IHC-P, IHC-Fr, ICC, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Fusion protein corresponding to amino acids 101 - 130 (

    YNKLQADPKQGMSLDIVLKKVKHRLVENMS

    ) of Rat PICK1 (AAG48152).

Properties

Applications

Our Abpromise guarantee covers the use of ab105585 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 47 kDa.
IHC-P Use a concentration of 0.1 - 1 µg/ml.
IHC-Fr Use a concentration of 0.1 - 1 µg/ml.
ICC Use a concentration of 0.1 - 1 µg/ml.
ICC/IF Use a concentration of 1 - 10 µg/ml.

Target

  • FunctionProbable adapter protein that bind to and organize the subcellular localization of a variety of membrane proteins containing some PDZ recognition sequence. Involved in the clustering of various receptors, possibly by acting at the receptor internalization level. Plays a role in synaptic plasticity by regulating the trafficking and internalization of AMPA receptors. May be regulated upon PRKCA activation. May regulate heteromeric ACCN3/ACCN2 channel.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesContains 1 AH domain.
    Contains 1 PDZ (DHR) domain.
  • Post-translational
    modifications
    Phosphorylation at Thr-82 appears to inhibit the interaction with AMPA receptors.
  • Cellular localizationCytoplasm > perinuclear region. Cell junction > synapse. Also present at excitatory synapses.
  • Information by UniProt
  • Database links
  • Alternative names
    • dJ1039K5 antibody
    • MGC15204 antibody
    • OTTHUMP00000028509 antibody
    • PICK 1 antibody
    • Pick1 antibody
    • PICK1_HUMAN antibody
    • PRKCA binding protein antibody
    • PRKCA-binding protein antibody
    • PRKCABP antibody
    • Protein interacting with C kinase 1 antibody
    • Protein interacting with PRKCA antibody
    • Protein interacting with PRKCA 1 antibody
    • Protein kinase C alpha binding protein antibody
    • Protein kinase C-alpha-binding protein antibody
    • Protein that interacts with C kinase 1 antibody
    see all

Anti-PICK1 antibody [S20-8] images

  • Immunohistochemical detection of Pick1 in frozen sections of Mouse brain extract using ab105585.


  • Predicted band size : 47 kDa
    Western blot detection of Pick1 in Rat brain membrane tissues using ab105585 at 1:1000 dilution.

References for Anti-PICK1 antibody [S20-8] (ab105585)

ab105585 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105585.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"