Overview

  • Product name
  • Description
    Rabbit polyclonal to PIG3
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human PIG3 aa 180-230 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    MAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCL A


    Database link: Q53FA7

  • Positive control
    • Human lung carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab214352 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    May be involved in the generation of reactive oxygen species (ROS). Has low NADPH-dependent naphtoquinone reductase activity, with a preference for 1,2-naphtoquinone over 1,4-naphtoquinone. Has low NADPH-dependent diamine reductase activity (in vitro).
  • Sequence similarities
    Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.
  • Information by UniProt
  • Database links
  • Alternative names
    • p53 induced gene 3 protein antibody
    • p53-induced gene 3 protein antibody
    • Putative quinone oxidoreductase antibody
    • QORX_HUMAN antibody
    • quinone oxidoreductase homolog antibody
    • Quinone oxidoreductase PIG3 antibody
    • TP53I3 antibody
    • Tumor protein p53 inducible protein 3 antibody
    • Tumor protein p53-inducible protein 3 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human lung carcinoma tissue labeling PIG3 with ab214352 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

ab214352 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214352.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up