Overview

  • Product name
    Anti-PIGZ antibody
  • Description
    Rabbit polyclonal to PIGZ
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PIGZ aa 276-318.
    Sequence:

    DSWYFSSPATSRNLVLTPVNFLHYNLNPQNLARHGTHARLTHL


    Database link: Q86VD9

  • Positive control
    • Human colon and gallbladder tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab188512 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Mannosyltransferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers a fourth mannose to some trimannosyl-GPIs during GPI precursor assembly. The presence of a fourth mannose in GPI is facultative and only scarcely detected, suggesting that it only exists in some tissues.
  • Tissue specificity
    Widely expressed at low level, with highest level in brain and colon.
  • Pathway
    Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis.
  • Sequence similarities
    Belongs to the glycosyltransferase 22 family. PIGZ subfamily.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • dol-P-Man dependent GPI mannosyltransferase antibody
    • GPI mannosyltransferase 4 antibody
    • GPI mannosyltransferase IV antibody
    • GPI-MT-IV antibody
    • hSMP3 antibody
    • Phosphatidylinositol glycan anchor biosynthesis class Z antibody
    • phosphatidylinositol glycan, class Z antibody
    • Phosphatidylinositol-glycan biosynthesis class Z protein antibody
    • PIG-Z antibody
    • Pigz antibody
    • PIGZ_HUMAN antibody
    • SMP3 antibody
    • SMP3 homolog antibody
    • SMP3 mannosyltransferase antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human colon tissue labeling PIGZ with ab188512 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human gallbladder tissue labeling PIGZ with ab188512 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling PIGZ with ab188512 at 1/50 dilution.

References

ab188512 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188512.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up