Overview

  • Product nameAnti-PILRA antibody
  • Description
    Rabbit polyclonal to PILRA
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 51-100 (IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFL N) of Human PILRA isoform 3 (NP_840057). Note: this aminoacid sequence is identical in all 4 isoforms of human PILRA.

  • Positive control
    • HepG2 cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG

Associated products

Applications

Our Abpromise guarantee covers the use of ab105605 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 µg/ml. Predicted molecular weight: 34 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionPaired receptors consist of highly related activating and inhibitory receptors and are widely involved in the regulation of the immune system. PILRA is thought to act as a cellular signaling inhibitory receptor by recruiting cytoplasmic phosphatases like PTPN6/SHP-1 and PTPN11/SHP-2 via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules.
  • Tissue specificityPredominantly detected in hemopoietic tissues and is expressed by monocytes, macrophages, and granulocytes, but not by lymphocytes. Also strongly expressed by dendritic cells (DC); preferentially by CD14+/CD1a- DC derived from CD34+ progenitors. Also expressed by CD11c+ blood and tonsil DC, but not by CD11c- DC precursors.
  • Sequence similaritiesContains 1 Ig-like V-type (immunoglobulin-like) domain.
  • DomainContains 2 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. PTPN6 seems to bind predominantly to the first ITIM motif.
  • Post-translational
    modifications
    According to PubMed:10660620, N- and O-glycosylated. According to PubMed:10903717, only N-glycosylated.
    Phosphorylated on tyrosine residues.
  • Cellular localizationSecreted and Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cell surface receptor FDF03 antibody
    • FDF03 antibody
    • Inhibitory receptor PILR-alpha antibody
    • paired immunoglobulin-like receptor alpha antibody
    • Paired immunoglobulin-like type 2 receptor alpha antibody
    • PILRA antibody
    • PILRA_HUMAN antibody
    see all

Anti-PILRA antibody images

  • Anti-PILRA antibody (ab105605) at 0.5 µg/ml + HepG2 cell lysate at 10 µg

    Predicted band size : 34 kDa

References for Anti-PILRA antibody (ab105605)

ab105605 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105605.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"