Overview

  • Product name
  • Description
    Mouse polyclonal to PIM2
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Full length protein corresponding to Human PIM2 aa 1-311.
    Sequence:

    MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGH RLTDRLQVAIKVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVI RLLDWFETQEGFMLVLERPLPAQDLFDYITEKGPLGEGPSRCFFGQVVAA IQHCHSRGVVHRDIKDENILIDLRRGCAKLIDFGSGALLHDEPYTDFDGT RVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFERDQEILEAELH FPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG GPAPLAWSLLP


    Database link: NP_006866.2

  • Positive control
    • PIM2-transfected 293T cell line lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172652 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 34 kDa.

Target

  • Function
    Promotes cell survival in response to a variety of proliferative signals via positive regulation of the I-kappaB kinase/NF-kappaB cascade; this process requires phosphorylation of MAP3K8/COT. Prevents apoptosis induced by growth factor withdrawal via inhibition of caspase-3 activation, and via phosphorylation of pro-apoptotic proteins. Inhibits BAD-induced cell death via phosphorylation of BAD. PIM2-mediated cell survival is glucose-dependent but independent of several AKT regulators such as PI3K, HSP-90 and TOR, indicating that PIM2 and PI3K/AKT/TOR function via distinct pathways. Involved in the positive regulation of chondrocyte survival and autophagy in the epiphyseal growth plate.
  • Tissue specificity
    Highly expressed in hematopoietic tissues, in leukemic and lymphoma cell lines, testis, small intestine, colon and colorectal adenocarcinoma cells. Weakly expressed in normal liver, but highly expressed in hepatocellular carcinoma tissues.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. PIM subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated.
  • Information by UniProt
  • Database links
  • Alternative names
    • OTTHUMP00000025825 antibody
    • Pim 2 oncogene antibody
    • Pim 2h antibody
    • Pim-2h antibody
    • PIM2 antibody
    • PIM2 Oncogene antibody
    • PIM2_HUMAN antibody
    • Pim2h antibody
    • Proto Oncogene PIM2 antibody
    • Proto-oncogene Pim-2 (serine threonine kinase) antibody
    • Serine/threonine kinase PIM2 antibody
    • Serine/threonine-protein kinase Pim-2 antibody
    see all

Images

  • All lanes : Anti-PIM2 antibody (ab172652) at 1 µg/ml

    Lane 1 : PIM2-transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG-HRP at 1/2500 dilution

    Developed using the ECL technique.

    Predicted band size: 34 kDa

References

ab172652 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172652.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up