Overview

  • Product name
    Anti-PIP4K2 alpha antibody
    See all PIP4K2 alpha primary antibodies
  • Description
    Rabbit polyclonal to PIP4K2 alpha
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide corresponding to Human PIP4K2 alpha aa 1-43.
    Sequence:

    MATPGNLGSSVLASKTKTKKKHFVAQKVKLFRASDPLLSVLMW

  • Positive control
    • A431, H1299, HeLa and HepG2 whole cell lysate. Human thyroid cancer tissue. HeLa cells.
  • General notes
    Keep as concentrated solution.

Properties

Applications

Our Abpromise guarantee covers the use of ab154585 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/3000. Predicted molecular weight: 46 kDa.
IHC-P 1/100 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF 1/100 - 1/1000.

Target

  • Function
    Catalyzes the phosphorylation of phosphatidylinositol-5-phosphate on the fourth hydroxyl of the myo-inositol ring, to form phosphatidylinositol-4,5-biphosphate.
  • Tissue specificity
    Expressed ubiquitously, with high levels in the brain. Present in most tissues, except notably skeletal muscle and small intestine.
  • Sequence similarities
    Contains 1 PIPK domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • 1 phosphatidylinositol 4 phosphate 5 kinase 2 alpha antibody
    • 1 phosphatidylinositol 4 phosphate 5 kinase antibody
    • 1 phosphatidylinositol 4 phosphate kinase antibody
    • 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha antibody
    • 4 5 kinase B isoform antibody
    • 4 5 kinase C isoform antibody
    • 4 5 kinase isoform 2 alpha antibody
    • Diphosphoinositide kinase 2 alpha antibody
    • Diphosphoinositide kinase 2-alpha antibody
    • FLJ13267 antibody
    • Phosphatidylinositol 4 phosphate 5 kinase type 2 alpha antibody
    • Phosphatidylinositol 4 phosphate 5 kinase type II alpha antibody
    • Phosphatidylinositol-5-phosphate 4-kinase type II alpha antibody
    • Phosphatidylinositol-5-phosphate 4-kinase type-2 alpha antibody
    • PI(5)P 4-kinase type II alpha antibody
    • PI42A_HUMAN antibody
    • PI5P4KA antibody
    • PIP4K2A antibody
    • PIP4KII-alpha antibody
    • PIP5K2 antibody
    • PIP5K2 alpha antibody
    • PIP5K2A antibody
    • PIP5KII alpha antibody
    • PIP5KII-alpha antibody
    • PIP5KIIA antibody
    • PIP5KIII antibody
    • PIPK antibody
    • PtdIns antibody
    • PtdIns(4)P-5-kinase B isoform antibody
    • PtdIns(4)P-5-kinase C isoform antibody
    • PtdIns(5)P-4-kinase isoform 2-alpha antibody
    • Type II phosphatidylinositol 4 phosphate 5 kinase 53 K isoform antibody
    see all

Images

  • All lanes : Anti-PIP4K2 alpha antibody (ab154585) at 1/1000 dilution

    Lane 1 : A431 whole cell lysate
    Lane 2 : H1299 whole cell lysate

    Lysates/proteins at 30 µg per lane.

    Predicted band size: 46 kDa

  • Immunofluorescent analysis of methanol-fixed HeLa cells labeling PIP4K2 alpha with ab154585 at 1/200 dilution. Lower panel co-stained with Hoechst 33342.

  • Immunohistochemical analysis of paraffin-embedded Human thyroid cancer tissue labeling PIP4K2 alpha with ab154585 at 1/100 dilution.

References

ab154585 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab154585.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up