Overview

  • Product name
  • Description
    Mouse polyclonal to PIP5K1 beta
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human PIP5K1 beta aa 201-310. NP_005662.
    Sequence:

    TYDLKGSTYKRRASRKEREKSNPTFKDLDFLQDMHEGLYFDTETYNALMK TLQRDCRVLESFKIMDYSLLLGIHFLDHSLKEKEEETPQNVPDAKRTGMQ KVLYSTAMES


    Database link: O14986

  • Positive control
    • Recombinant Human PIP5K1 beta protein fragment (immunogen); Y79 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab194379 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 61 kDa.

Use at 1/500 - 1/1000 dilution for cell/tissue lysates and mammalian overexpressed lysate, or at 1/1000 - 1/2500 for recombinant protein.

Target

  • Function
    Mediates RAC1-dependent reorganization of actin filaments (By similarity). Participates in the biosynthesis of phosphatidylinositol-4,5-bisphosphate.
  • Tissue specificity
    Detected in heart, pancreas, brain, kidney, skeletal muscle and lung.
  • Sequence similarities
    Contains 1 PIPK domain.
  • Cellular localization
    Endomembrane system. Associated with membranes.
  • Information by UniProt
  • Database links
  • Alternative names
    • MSS 4 antibody
    • MSS4 antibody
    • Phosphatidylinositol 4 phosphate 5 kinase type 1 beta antibody
    • Phosphatidylinositol-4-phosphate 5-kinase type I beta antibody
    • Phosphatidylinositol-4-phosphate 5-kinase type-1 beta antibody
    • PI4P5K 1 beta antibody
    • PI51B_HUMAN antibody
    • PIP5K1-beta antibody
    • PIP5K1B antibody
    • PIP5KIbeta antibody
    • Pipk 5 beta antibody
    • Pipk 5b antibody
    • Protein STM 7 antibody
    • Protein STM-7 antibody
    • PtdIns(4)P-5-kinase 1 beta antibody
    • STM 7 antibody
    • STM7 antibody
    • STM7 LSB antibody
    • Type I phosphatidylinositol 4 phosphate 5 kinase beta antibody
    • Type I phosphatidylinositol-4-phosphate 5-kinase beta antibody
    see all

Images

  • Anti-PIP5K1 beta antibody (ab194379) at 1/1000 dilution + recombinant Human PIP5K1 beta protein fragment (immunogen) at 0.2 µg

    Predicted band size : 61 kDa
  • Anti-PIP5K1 beta antibody (ab194379) at 1/500 dilution + Y79 cell lysate at 50 µg

    Predicted band size : 61 kDa

References

ab194379 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194379.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up