Overview

  • Product nameAnti-PIP5K2 alpha antibody
    See all PIP5K2 alpha primary antibodies
  • Description
    Rabbit polyclonal to PIP5K2 alpha
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 107-156 (

    IDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMH

    ) of Human PIP5K2 alpha (NP_005019)

  • Positive control
    • Human Fetal brain lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab98195 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 46 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionCatalyzes the phosphorylation of phosphatidylinositol-5-phosphate on the fourth hydroxyl of the myo-inositol ring, to form phosphatidylinositol-4,5-biphosphate.
  • Tissue specificityExpressed ubiquitously, with high levels in the brain. Present in most tissues, except notably skeletal muscle and small intestine.
  • Sequence similaritiesContains 1 PIPK domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • 1 phosphatidylinositol 4 phosphate 5 kinase 2 alpha antibody
    • 1 phosphatidylinositol 4 phosphate 5 kinase antibody
    • 1 phosphatidylinositol 4 phosphate kinase antibody
    • 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha antibody
    • 4 5 kinase B isoform antibody
    • 4 5 kinase C isoform antibody
    • 4 5 kinase isoform 2 alpha antibody
    • Diphosphoinositide kinase 2 alpha antibody
    • Diphosphoinositide kinase 2-alpha antibody
    • FLJ13267 antibody
    • Phosphatidylinositol 4 phosphate 5 kinase type 2 alpha antibody
    • Phosphatidylinositol 4 phosphate 5 kinase type II alpha antibody
    • Phosphatidylinositol-5-phosphate 4-kinase type II alpha antibody
    • Phosphatidylinositol-5-phosphate 4-kinase type-2 alpha antibody
    • PI(5)P 4-kinase type II alpha antibody
    • PI42A_HUMAN antibody
    • PI5P4KA antibody
    • PIP4K2A antibody
    • PIP4KII-alpha antibody
    • PIP5K2 antibody
    • PIP5K2A antibody
    • PIP5KII alpha antibody
    • PIP5KII-alpha antibody
    • PIP5KIIA antibody
    • PIP5KIII antibody
    • PIPK antibody
    • PtdIns antibody
    • PtdIns(4)P-5-kinase B isoform antibody
    • PtdIns(4)P-5-kinase C isoform antibody
    • PtdIns(5)P-4-kinase isoform 2-alpha antibody
    • Type II phosphatidylinositol 4 phosphate 5 kinase 53 K isoform antibody
    see all

Anti-PIP5K2 alpha antibody images

  • Anti-PIP5K2 alpha antibody (ab98195) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal brain lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 46 kDa

References for Anti-PIP5K2 alpha antibody (ab98195)

ab98195 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98195.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"