Overview

  • Product name
  • Description
    Rabbit polyclonal to PITX2
  • Host species
    Rabbit
  • Specificity
    ab192495 detects endogenous levels of PITX2 protein.
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human PITX2 aa 1-317.
    Sequence:

    METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASS KFFPRQHPGA NEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQ ELEATFQRNRYPDMSTREEIAV WTNLTEARVRVWFKNRRAKWRKRERN QQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWA AKGLTSASLSTKSF PFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLN SL NNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHS SFGYASVQ NPASNLSACQYAVDRPV


    Database link: Q99697

Properties

Applications

Our Abpromise guarantee covers the use of ab192495 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB Use at an assay dependent concentration.

Target

  • Function
    May play an important role in development and maintenance of anterior structures. Isoform PTX2C is involved in left-right asymmetry the developing embryo.
  • Involvement in disease
    Defects in PITX2 are the cause of Axenfeld-Rieger syndrome type 1 (RIEG1) [MIM:180500]; also known as Rieger syndrome type 1. RIEG1 is an autosomal dominant defect characterized by hypodontia (partial anodontia), anal stenosis, hypertelorism, mental deficiency, agenesis of the facial bones, with malformation of the anterior chamber of the eye.
    Defects in PITX2 are the cause of iridogoniodysgenesis type 2 (IRID2) [MIM:137600]; also known as iridogoniodysgenesis syndrome 2 (IGDS2). It is an autosomal dominant inherited disease.
    Defects in PITX2 are a cause of Peters anomaly (PAN) [MIM:604229]. It is a congenital defect of the anterior chamber of the eye.
    Defects in PITX2 are associated with ring dermoid of cornea (RDC) [MIM:180550]. RDC is an autosomal dominantly inherited syndrome characterized by bilateral annular limbal dermoids with corneal and conjunctival extension.
  • Sequence similarities
    Belongs to the paired homeobox family. Bicoid subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • All1 responsive gene 1 antibody
    • ALL1 responsive protein ARP1 antibody
    • ALL1-responsive protein ARP1 antibody
    • ARP 1 antibody
    • ARP1 antibody
    • Brx 1 antibody
    • Brx1 antibody
    • Homeobox protein PITX2 antibody
    • IDG 2 antibody
    • IDG2 antibody
    • IGDS 2 antibody
    • IGDS antibody
    • IGDS2 antibody
    • IHG 2 antibody
    • IHG2 antibody
    • IRID 2 antibody
    • IRID2 antibody
    • MGC111022 antibody
    • MGC20144 antibody
    • Otlx 2 antibody
    • Otlx2 antibody
    • Paired like homeodomain transcription factor 2 antibody
    • Paired-like homeodomain transcription factor 2 antibody
    • Pituitary homeo box 2 antibody
    • Pituitary homeobox 2 antibody
    • PITX 2 antibody
    • pitx2 antibody
    • PITX2_HUMAN antibody
    • PTX 2 antibody
    • PTX2 antibody
    • RGS antibody
    • RIEG 1 antibody
    • RIEG antibody
    • Rieg bicoid related homeobox transcription factor 1 antibody
    • RIEG bicoid related homeobox transcription factor antibody
    • RIEG bicoid-related homeobox transcription factor antibody
    • RIEG1 antibody
    • RS antibody
    • Solurshin antibody
    see all

References

This product has been referenced in:
  • Wang Q  et al. Smad4-dependent suppressor pituitary homeobox 2 promotes PPP2R2A-mediated inhibition of Akt pathway in pancreatic cancer. Oncotarget 7:11208-22 (2016). ChIP . Read more (PubMed: 26848620) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192495.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up