Overview

  • Product nameAnti-PIWIL2 antibody
    See all PIWIL2 primary antibodies
  • Description
    Rabbit polyclonal to PIWIL2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 287-336 (QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLD M) of Human PIWIL2 (NP_060538).

  • Positive control
    • Human fetal small intestine lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab98852 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 110 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionPlays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity. Plays an essential role in meiotic differentiation of spermatocytes, germ cell differentiation and in self-renewal of spermatogonial stem cells. Its presence in oocytes suggests that it may participate to similar functions during oogenesis in females. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Directly binds piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. Associates with primary piRNAs in the cytoplasm and is required for PIWIL4/MIWI2 nuclear localization and association with secondary piRNAs antisense. The piRNA process acts upstream of known mediators of DNA methylation. Participates to a piRNA amplification loop. Besides their function in transposable elements repression, piRNAs are probably involved in other processes during meiosis such as translation regulation. Indirectly modulate expression of genes such as PDGFRB, SLC2A1, ITGA6, GJA7, THY1, CD9 and STRA8. Inhibits tumor cell growth when repressed. When overexpressed, acts as an oncogene by inhibition of apoptosis and promotion of proliferation in tumors.
  • Tissue specificityExpressed in adult testis and in most tumors.
  • Sequence similaritiesBelongs to the argonaute family. Piwi subfamily.
    Contains 1 PAZ domain.
    Contains 1 Piwi domain.
  • Post-translational
    modifications
    Arginine methylation by PRMT5 is required for the interaction with Tudor domain-containing protein TDRD1 and subsequent localization to the meiotic nuage, also named P granule.
  • Cellular localizationCytoplasm. Present in chromatoid body. Probable component of the meiotic nuage, also named P granule, a germ-cell-specific organelle required to repress transposon during meiosis.
  • Information by UniProt
  • Database links
  • Alternative names
    • Cancer/testis antigen 80 antibody
    • CT80 antibody
    • Hiwi like antibody
    • MILI antibody
    • Miwi like antibody
    • Piwi like 2 antibody
    • Piwi-like protein 2 antibody
    • Piwil2 antibody
    • PIWL2_HUMAN antibody
    see all

Anti-PIWIL2 antibody images

  • Anti-PIWIL2 antibody (ab98852) at 1 µg/ml + Human small intestine lysate at 10 µg

    Predicted band size : 110 kDa

References for Anti-PIWIL2 antibody (ab98852)

ab98852 has not yet been referenced specifically in any publications.

Product Wall

Abcam has not validated the combination of species/application used in this Abreview.
Application Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample Marmoset (common) Tissue sections (Adult marmoset testis)
Specification Adult marmoset testis
Fixative Formaldehyde
Antigen retrieval step Heat mediated - Buffer/Enzyme Used: Dako Antigen retrieval solution
Permeabilization No
Blocking step Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 25°C
Username

煜欽 林

Verified customer

Submitted Aug 29 2012

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"