Overview

  • Product name
  • Description
    Mouse polyclonal to PKC mu
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Full length protein corresponding to Human PKC mu aa 1-912. NCBI: AAI60015.1
    Sequence:

    MSAPPVLRPPSPLLPVAAAAAAAAAALVPGSGPGPAPFLAPVAAPVGGIS FHLQIGLSREPVLLLQDSSGDYSLAHVREMACSIVDQKFPECGFYGMYDK ILLFRHDPTSENILQLVKAASDIQEGDLIEVVLSASATFEDFQIRPHALF VHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVR RRRLSNVSLTGVSTIRTSSAELSTSAPDEPLLQKSPSESFIGREKRSNSQ SYIGRPIHLDKILMSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQ CKDCRFNCHKRCAPKVPNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDS ERNSGLMDDMEEAMVQDAEMAMAECQNDSGEMQDPDPDHEDANRTISPST SNNIPLMRVVQSVKHTKRKSSTVMKEGWMVHYTSKDTLRKRHYWRLDSKC ITLFQNDTGSRYYKEIPLSEILSLEPVKTSALIPNGANPHCFEITTANVV YYVGENVVNPSSPSPNNSVLTSGVGADVARMWEIAIQHALMPVIPKGSSV GTGTNLHRDISVSISVSNCQIQENVDISTVYQIFPDEVLGSGQFGIVYGG KHRKTGRDVAIKIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFE TPERVFVVMEKLHGDMLEMILSSEKGRLPEHITKFLITQILVALRHLHFK NIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYL APEVLRNKGYNRSLDMWSVGVIIYVSLSGTFPFNEDEDIHDQIQNAAFMY PPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQDYQTWLDLRE LECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEET EMKALGERVSIL


    Database link: Q15139

  • Positive control
    • Lysate from 293T cells transfected with PKC mu.

Properties

Applications

Our Abpromise guarantee covers the use of ab172096 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 102 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function
    Converts transient diacylglycerol (DAG) signals into prolonged physiological effects, downstream of PKC. Involved in resistance to oxidative stress through activation of NF-kappa-B.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. PKD subfamily.
    Contains 1 PH domain.
    Contains 2 phorbol-ester/DAG-type zinc fingers.
    Contains 1 protein kinase domain.
  • Cellular localization
    Cytoplasm. Membrane. Translocation to the cell membrane is required for kinase activation.
  • Information by UniProt
  • Database links
  • Alternative names
    • KPCD1_HUMAN antibody
    • nPKC D1 antibody
    • nPKC mu antibody
    • nPKC-D1 antibody
    • nPKC-mu antibody
    • nPKCD1 antibody
    • nPKCmu antibody
    • PKC antibody
    • PKC MU antibody
    • PKCM antibody
    • PKCmu antibody
    • PKD 1 antibody
    • PKD antibody
    • PKD1 antibody
    • PRKCM antibody
    • PRKD 1 antibody
    • Prkd1 antibody
    • Protein kinase C mu antibody
    • Protein kinase C mu type antibody
    • Protein kinase D antibody
    • Protein kinase D1 antibody
    • Serine/threonine protein kinase D1 antibody
    • Serine/threonine-protein kinase D1 antibody
    see all

Images

  • Immunofluorescence of ab172096 on HeLa cell. [antibody concentration 10 ug/ml]

  • All lanes : Anti-PKC mu antibody (ab172096) at 1 µg/ml

    Lane 1 : Lysate from 293T cells transfected with PKC mu
    Lane 2 : Lysate from untransfected 293T cells

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 102 kDa

References

ab172096 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Loading amount
20 µg
Gel Running Conditions
Reduced Denaturing (8%)
Sample
Rat Cell lysate - whole cell (Astrocytes)
Specification
Astrocytes
Treatment
Control, Insulin 10nM, IGF-1nM or both hormones 10nM for 15 minutes
Blocking step
Milk as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Username

Mr. Edwin Hernandez

Verified customer

Submitted May 30 2014

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up